SecReT4
Protein ID: 134044797
T4SS name [ID]Tra_F [585]
Gene symboltraI
Locus tagYpIP275_pIP1202_0093
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]64226..67204 [+]
Producttype IV conjugative transfer system protein TraI
Component typeTraI_F
UniProt IDA4IUV1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 2e-118, Aligned region: 46..357
Protein Sequence: 992 a.a.     [Download]
>gi|134044797|ref|YP_001102157.1| type IV conjugative transfer system protein TraI [Yersinia pestis biovar Orientalis str. IP275]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET
 
Nucleotide Sequence: 2979 bp     [Download]
>gi|134044743|ref|NC_009141.1|:64226-67204 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGCTGAAAGCCCTTAACAAGTTATTTGGTGGGCGAAGTGGAGTGATCGAGACCGCGCCGAGCGCCAGAG
TGTTGCCGCTTAAAGACGTGGAAGATGAAGAAATCCCTCGATACCCACCTTTTGCCAAGGGCCTGCCAGT
GGCCCCACTAGACAAGATACTGGCAACCCAAGCTGAACTGATTGAGAAAGTGCGGAACTCTCTCGGTTTC
ACTGTGGACGACTTCAACCGGCTTGTTTTGCCGGTGATCCAGCGGTATGCCGCGTTTGTTCACCTGTTGC
CAGCTTCCGAATCACACCACCACCGTGGCGCTGGTGGTCTGTTCCGACATGGGCTTGAAGTGGCCTTCTG
GGCAGCTCAGGCATCTGAGTCAGTTATCTTTTCCATCGAGGGGACGCCTCGGGAACGCCGTGACAATGAG
CCGCGTTGGAGACTGGCGAGCTGTTTCTCTGGGCTGCTGCATGATGTGGGTAAACCGCTCTCGGATGTGT
CCATTACGGACAAAGACGGGTCAATCACATGGAACCCGTATTCGGAGTCACTTCATGACTGGGCACACCG
TCACGAAATCGACCGTTACTTTATCCGGTGGCGCGACAAGCGACACAAAAGACATGAGCAATTCTCGCTG
CTGGCGGTGGATCGAATTATTCCGGCTGAGACTCGGGAGTTTCTGTCCAAGTCTGGCCCGTCCATCATGG
AAGCGATGCTGGAAGCTATCTCAGGAACCAGCGTCAATCAGCCTGTGACCAAGCTGATGCTTCGCGCTGA
CCAAGAGAGCGTCTCACGGGACCTTCGCCAGAGTCGTCTCGATGTGGACGAGTTCTCCTATGGTGTGCCC
GTCGAGCGTTACGTGTTCGATGCCATCCGCCGCCTGGTTAAAACCGGAAAATGGAAGGTCAATGAGCCAG
GCGCGAAAGTCTGGCACCTCAACCAAGGTGTATTCATTGCCTGGAAACAGCTTGGGGACCTTTATGACTT
GATCAGCCACGACAAGATCCCCGGTATCCCACGAGACCCTGACACACTGGCCGACATTCTCATCGAACGT
GGTTTTGCTGTACCAAACACGGTGCAGGAGAAGGGTGAACGTGCGTACTACCGCTACTGGGAAGTTTTGC
CTGAGATGCTCCAGGAGGCGGCGGGTTCGGTGAAGATCTTGATGCTCCGACTCGAATCAAACGACCTGGT
GTTTACGACTGAGCCTCCTGCGGCTGTTGCTGCGGAAGTTGTTGGTGATGTTGAGGACGCTGAGATTGAG
TTCGTTGATCCTGAGGAAGCCGATGACGGTGACGACCAAGAGGAAGGTGAAGCAGCTCTGAACGATGACA
TGTTGGCCGCAGAGCAGGAAGCAGAGAAAGCTCTAGCTGGCCTTGGCTTTGGTGATGCGATGGAGATGCT
GAAAAGCACCTCCGATGCTGTCGAGGAGAAGCCAGAGCAAAAAGATGCGGGACCAACGGAATCATCTAAG
CCTGACGCTGGCAAGAAGGGTAAGCCGCAGAGCAAACCGGGCAAAGCAAAACCGAAGAGTGATACGGAGA
AACAACCCCATAAACCAGAGGCAAAAGAGGATCTGTCCCCTCAGGACATTGCCAAAAACGCACCACCTTT
GGCAAACGACAATCCGTTACAAGCACTCAAGGATGTTGGGGGTGGACTGGGGGACATCGACTTCCCGTTT
GACGCATTCAACGCATCGGCAGAGACAACCAGCACTGACGCAACAAACTCAGAAATCCCAGATGTGGCAA
TGCCCGGAAAGCAAGAGGAGCAGCCAAAACAGGACTTCGTTCCACAAGAACAAAACTCCCTGCAGGGCGA
TGACTTTCCAATGTTCGGTGGTTCTGATGAACCGCCATCATGGGCGATTGAGCCGCTCCCTATGCTGACT
GACGCACCAGAACAACCAACGCACACGCCAGAAATGCCGCATACGGACAACGTTAATCAGCATGAGAAGG
ACGCAAAGACCTTGCTCGTTGAGATGTTGTCTGGATACGGGGAAGCATCGGCGTTGCTTGAACAAGCGAT
CATGCCTGTTTTGGAAGGTAAAACGACGCTGGGCGAAGTCCTATGCCTGATGAAGGGGCAAGCCGTCATT
TTGTACCCGGATGGCGCTCGGTCGCTGGGTGCGCCGTCAGAGGTTCTCTCGAAGCTGTCCCACGCCAACG
CGATTGTTCCGGACCCGATTATGCCAGGTCGCAAAGTTCGTGATTTCAGCGGAGTGAAGGCAATTGTACT
GGCGGAGCAGCTTTCAGATGCAGTCGTGGCGGCCATTAAGGATGCCGAGGCGTCAATGGGTGGATACCAG
GATGCCTTTGAGCTCGTCTCTCCCCCTGGCTTGGATGCAAGCAAAAATAAGTCTGCACCGAAACAACAAA
GCCGAAAAAAGGCGCAGCAGCAGAAGCCTGAGGTTAATGCCGGTAAAGCCTCGCCTGAACAAAAGGCGAA
AGGTAAGGACTCCCAGCCACAGCCGAAGGAGAAGAAGGTCGATGTTACTTCTCCGGTTGAAGAGCAACAG
CGCAAGCCGGTCCAAGAAAAACAGAACGTGGCTCGCCTTCCTAAGCGGGAGGCTCAACCGGTGGCTCCTG
AGCCCAAAGTTGAGCGTGAGAAGGAATTGGGACACGTCGAGGTGCGAGAAAGGGAAGATCCAGAGGTTAG
GGAGTTTGAGCCGCCTAAGGCGAAAACAAACCCGAAAGACATCAACGCGGAAGATTTCTTGCCGTCTGGT
GTTACGCCTCAGAAAGCACTCCAGATGCTCAAGGACATGATCCAAAAACGCTCGGGCCGATGGCTCGTGA
CACCTGTCCTGGAAGAGGATGGCTGCTTAGTAACCAGTGACAAAGCCTTCGACATGATTGCCGGTGAAAA
CATCGGCATCAGCAAACACATCCTCTGCGGGATGCTGAGCCGGGCACAGAGACGCCCTTTGCTCAAGAAA
CGTCAGGGAAAATTGTATTTAGAGGTAAATGAAACATGA
 Primer design