SecReT4
Protein ID: 134044802
T4SS name [ID]Tra_F [585]
Gene symboltraE
Locus tagYpIP275_pIP1202_0102
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]72876..73502 [+]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDA4IUW0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-11, Aligned region: 27..170
Protein Sequence: 208 a.a.     [Download]
>gi|134044802|ref|YP_001102166.1| type IV conjugative transfer system protein TraE [Yersinia pestis biovar Orientalis str. IP275]
MNLKKYLKTWEGTQTENKWGRIFQGGLIAIVFLLVVQVFSKETIVTIQPFTLTEEAWVTKNNASQSYKEA
WGFAFAQLLGNVTPGTVDFVKERITPLLSPSIYQDVIDAIEIQAQQIKNDRVTMRFEPRFVEYEPKSDKV
FVYGYSYVKGASSNEERSERSYEFAIKISNYAPVLDYIDTYVGKPRTKTVLEQLQRKEENRRKHEEQR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|134044743|ref|NC_009141.1|:72876-73502 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
TTGAACCTGAAAAAGTATCTCAAGACCTGGGAAGGGACCCAAACAGAAAATAAGTGGGGACGAATCTTCC
AGGGTGGTCTTATTGCTATCGTTTTCCTGCTGGTGGTCCAAGTATTCAGCAAGGAAACCATCGTCACTAT
CCAGCCTTTCACGCTCACGGAAGAAGCCTGGGTGACGAAAAATAACGCCTCTCAGTCCTATAAAGAGGCT
TGGGGTTTCGCTTTTGCTCAGCTCCTTGGCAATGTGACGCCAGGAACCGTTGACTTTGTGAAAGAACGGA
TCACCCCGCTTCTCTCCCCGAGCATCTATCAGGACGTGATTGATGCCATCGAAATTCAAGCTCAACAGAT
CAAGAACGACCGCGTAACCATGCGGTTTGAGCCGCGTTTTGTTGAGTACGAGCCCAAGAGCGACAAGGTG
TTTGTCTACGGATATTCCTACGTCAAAGGGGCTTCTTCTAACGAAGAGCGTAGCGAACGCTCCTACGAGT
TCGCCATCAAGATTTCAAACTACGCGCCCGTGCTGGACTACATCGACACCTATGTAGGAAAGCCACGCAC
CAAAACTGTTTTGGAGCAACTCCAGCGCAAAGAAGAAAACCGGAGAAAGCATGAAGAACAACGCTAA
 Primer design