SecReT4
Protein ID: 134044806
T4SS name [ID]Tra_F [585]
Gene symbol-
Locus tagYpIP275_pIP1202_0216
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]179263..179796 [+]
Producttransglycosylase SLT domain-containing protein
Component typeOrf169_F
UniProt IDA4IV70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 177 a.a.     [Download]
>gi|134044806|ref|YP_001102276.1| transglycosylase SLT domain-containing protein [Yersinia pestis biovar Orientalis str. IP275]
MKNKAKALVLSAALLSSTANAIDLSGTIFDKAAKAYNLDPLLVYSVALAESASGRGNGSISPWPWTLRVP
GLPFYAKSEDQAKAKLAEFQQQYGRAIDVGFMQVSIRWNGHRVSSPADLLDPETNVMVGAEVLSEAIQSS
PNDLELGVGRYHAWEDEIRARNYGSRVLAIYRNLRDL
 
Nucleotide Sequence: 534 bp     [Download]
>gi|134044743|ref|NC_009141.1|:179263-179796 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGAAGAACAAAGCCAAGGCGCTAGTTCTGTCTGCGGCTCTCCTTTCATCAACAGCGAATGCTATTGACC
TGAGCGGAACCATCTTCGACAAAGCAGCGAAAGCATATAACCTCGACCCTCTTCTAGTGTATTCGGTCGC
ATTGGCCGAATCTGCATCAGGGAGAGGTAATGGCTCTATAAGTCCTTGGCCTTGGACGCTTCGCGTTCCT
GGGCTTCCTTTCTATGCTAAGTCGGAAGATCAGGCAAAGGCTAAGCTCGCTGAGTTTCAGCAGCAGTACG
GTCGTGCCATTGATGTCGGGTTTATGCAAGTGAGCATCCGGTGGAATGGTCATAGAGTTTCTTCTCCAGC
AGATCTTCTCGACCCAGAGACCAACGTCATGGTTGGGGCAGAGGTGCTATCAGAAGCCATTCAGTCATCT
CCAAATGACTTGGAGCTTGGCGTTGGCCGCTATCACGCCTGGGAAGACGAAATCCGAGCCAGAAACTATG
GTAGCCGAGTCTTGGCTATCTATCGCAACCTTCGTGATTTGTGA
 Primer design