SecReT4
Protein ID: 134044828
T4SS name [ID]Tra_F [585]
Gene symbol-
Locus tagYpIP275_pIP1202_0103
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]73486..74403 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDA4IUW1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.3e-22, Aligned region: 62..283
Protein Sequence: 305 a.a.     [Download]
>gi|134044828|ref|YP_001102167.1| hypothetical protein YpIP275_pIP1202_0103 [Yersinia pestis biovar Orientalis str. IP275]
MKNNAKLSLLALSLALGTSMAYASDDIPVVPASVMKKDVPAPVTSGQSSHEVVGSMNENPLLTMKPGVNQ
IIPIAVGHPNRIVTPFSNPEIVSTSLTGATDNGQCGEVCIKENVVYVATDKQYPVTMFITEKGSEAQALS
LTMVPRRIPPREVFLKLDGGVGITGAFANTKAETWEQSQPYVETIRSVFRKIALGEVPQGYTLNRIPAGA
AVPSCAHPGVKVDFSKGQYMMGHHLNVFIGVALNVSDQPIEFKEALCGSWDVAAVTTWPLNVLEPGQKTE
IYVAKKQKRGLAPTSKRPSLLGGAQ
 
Nucleotide Sequence: 918 bp     [Download]
>gi|134044743|ref|NC_009141.1|:73486-74403 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGAAGAACAACGCTAAACTTTCGCTCCTGGCGCTGTCCTTGGCGCTTGGAACTTCAATGGCCTATGCCT
CGGATGACATTCCTGTTGTCCCGGCCAGTGTTATGAAAAAGGATGTTCCTGCCCCTGTGACGTCAGGACA
AAGCTCCCATGAGGTTGTGGGCAGCATGAATGAAAACCCCTTACTGACGATGAAGCCGGGGGTTAACCAG
ATCATCCCGATAGCCGTTGGTCATCCGAACCGAATCGTCACGCCTTTCAGCAATCCTGAGATCGTTTCAA
CATCTCTGACCGGGGCGACGGATAACGGCCAGTGTGGTGAGGTCTGCATCAAAGAGAATGTGGTCTATGT
CGCCACGGATAAGCAGTATCCGGTGACTATGTTCATTACTGAAAAAGGCTCGGAAGCCCAAGCTCTCAGC
CTGACGATGGTTCCCCGTCGTATTCCGCCCAGAGAAGTCTTTCTCAAGCTCGATGGTGGTGTAGGTATCA
CTGGTGCTTTTGCCAATACCAAGGCTGAGACCTGGGAACAGAGCCAGCCTTATGTCGAAACCATCCGGTC
AGTATTCCGAAAGATTGCTCTTGGTGAAGTCCCTCAAGGTTACACGTTGAACCGCATCCCTGCTGGTGCT
GCGGTGCCGAGCTGCGCTCATCCTGGGGTAAAGGTGGATTTTAGCAAGGGGCAATACATGATGGGCCACC
ACCTTAACGTGTTCATCGGTGTCGCCCTGAACGTCTCTGATCAGCCTATTGAGTTCAAAGAGGCGTTGTG
TGGGAGCTGGGATGTGGCTGCGGTGACTACGTGGCCGCTTAACGTGCTTGAGCCCGGCCAGAAGACGGAG
ATCTATGTGGCGAAGAAGCAGAAGCGTGGTCTCGCACCAACGTCTAAGCGTCCATCGCTGCTGGGAGGTG
CCCAATGA
 Primer design