SecReT4
Protein ID: 134044850
T4SS name [ID]Tra_F [585]
Gene symboltraC
Locus tagYpIP275_pIP1202_0109
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]83272..85719 [+]
Producttype IV conjugative transfer system protein TraC
Component typeTraC_F
UniProt IDA4IUW7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 3.6e-58, Aligned region: 20..255
AAA_10 [PF12846], Evalue: 2.3e-54, Aligned region: 451..729
DUF87 [PF01935], Evalue: 3.7e-06, Aligned region: 452..591
Protein Sequence: 815 a.a.     [Download]
>gi|134044850|ref|YP_001102173.1| type IV conjugative transfer system protein TraC [Yersinia pestis biovar Orientalis str. IP275]
MIVTIKKKLEETLIPEHLRAAGIIPVLAYDEDDHVFLMDDHSAGFGFMCEPLCGADEKVQERMNGFLNQE
FPSKTTLQFVLFRSPDINQEMYRMMGLRDGFRHELLTSVIKERINFLQHHTTERIFAKTNKGIYDNGLIQ
DLKLFVTCKVPIKNNNPTESELQQLAQLRTKVESSLQTVGLRPRTMTAVNYIRIMSTILNWGPDASWRHD
SVDWEMDKPICEQIFDYGTDVEVSKNGIRLGDYHAKVMSAKKLPDVFYFGDALTYAGDLSGGNSSIKENY
MVVTNVFFPEAESTKNTLERKRQFTVNQAYGPMLKFVPVLADKKESFDTLYESMKEGAKPVKITYSVVLF
APTKERVEAAAMAARNIWRESRFELMEDKFVALPMFLNCLPFCTDRDAVRDLFRYKTMTTEQAAVVLPVF
GEWKGTGTYHAALISRNGQLMSLSLHDSNTNKNLVIAAESGSGKSFLTNELIFSYLSEGAQVWVIDAGKS
YQKLSEMLNGDFVHFEEGTHVCLNPFELIQNYEDEEDAIVSLVCAMASAKGLLDEWQISALKQVLSRLWE
EKGKEMKVDDIAERCLEEENDQRLKDIGQQLYAFTSKGSYGKYFSRKNNVSFQNQFTVLELDELQGRKHL
RQVVLLQLIYQIQQEVFLGERNRKKVVIVDEAWDLLKEGEVSVFMEHAYRKFRKYGGSVVIATQSINDLY
ENAVGRAIAENSASMYLLGQTEETVESVKRSGRLTLSEGGFHTLKTVHTIQGVYSEIFIKSKSGMGVGRL
IVGDFQKLLYSTDPVDVNAIDQFVKQGMSIPEAIKAVMRSRQQAA
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|134044743|ref|NC_009141.1|:83272-85719 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGATCGTAACCATCAAAAAGAAACTCGAAGAAACGTTGATCCCGGAGCACTTGCGAGCTGCCGGGATTA
TTCCTGTCCTGGCCTATGACGAAGACGATCATGTCTTCCTTATGGATGACCACAGTGCAGGCTTTGGTTT
CATGTGTGAGCCCCTGTGTGGTGCCGATGAAAAAGTTCAGGAGCGAATGAACGGTTTCCTGAATCAGGAG
TTCCCGTCGAAGACTACGCTCCAGTTTGTTCTGTTCCGCTCCCCGGACATCAATCAGGAGATGTACCGGA
TGATGGGGTTGCGTGATGGCTTCCGTCACGAGCTGCTGACATCTGTCATCAAGGAACGGATTAACTTCCT
CCAGCACCACACGACAGAACGCATATTTGCCAAGACCAACAAAGGTATCTACGACAATGGCTTGATCCAA
GACCTCAAGCTGTTCGTTACGTGCAAAGTCCCCATCAAGAACAATAACCCGACTGAAAGCGAACTCCAGC
AGCTCGCACAGCTTCGCACGAAGGTCGAATCATCGCTTCAAACCGTTGGTCTGCGTCCCCGCACAATGAC
GGCGGTGAACTACATCCGGATCATGAGCACCATCCTGAATTGGGGGCCGGATGCTTCATGGCGACATGAC
TCTGTGGATTGGGAGATGGATAAGCCCATCTGCGAGCAAATCTTCGATTACGGCACTGATGTGGAAGTCA
GCAAGAACGGCATCAGGCTGGGGGACTACCACGCGAAAGTCATGTCAGCGAAAAAGCTGCCTGACGTTTT
CTACTTTGGTGATGCGTTGACCTATGCCGGGGATCTCAGCGGCGGCAACTCCAGCATCAAAGAAAACTAC
ATGGTTGTGACCAATGTGTTTTTCCCTGAGGCAGAAAGCACGAAAAACACTCTGGAGCGCAAACGCCAGT
TCACTGTAAACCAAGCCTACGGGCCGATGCTCAAATTCGTGCCGGTGCTGGCGGACAAAAAGGAGAGCTT
CGACACTCTCTATGAGTCCATGAAAGAGGGGGCTAAGCCAGTCAAGATCACCTACTCGGTGGTTTTATTT
GCTCCAACCAAAGAACGTGTTGAAGCGGCGGCGATGGCCGCACGAAACATCTGGCGTGAATCTCGGTTCG
AGCTGATGGAGGATAAGTTCGTTGCTCTGCCGATGTTCCTCAACTGCCTGCCATTCTGTACAGACCGGGA
TGCAGTGCGAGACCTATTCCGCTACAAGACCATGACAACCGAGCAGGCGGCTGTGGTCCTGCCGGTGTTT
GGGGAATGGAAGGGGACCGGGACCTATCATGCAGCGCTGATTTCCCGCAACGGCCAGCTCATGAGTCTGT
CTCTTCACGACAGTAATACCAACAAAAACCTGGTGATCGCAGCCGAATCCGGCTCGGGTAAATCGTTCCT
TACCAACGAACTGATTTTTTCCTACTTGTCCGAGGGTGCTCAGGTCTGGGTTATTGATGCCGGTAAGTCC
TACCAGAAGCTGTCGGAAATGCTCAATGGCGACTTCGTTCACTTTGAAGAAGGAACGCACGTCTGCCTCA
ACCCGTTCGAGCTCATACAGAACTACGAGGACGAAGAAGACGCGATTGTCAGCCTCGTTTGTGCAATGGC
GTCGGCCAAAGGCTTGCTGGATGAATGGCAAATCTCTGCGCTGAAACAGGTCCTTTCTCGCCTGTGGGAA
GAGAAAGGTAAAGAGATGAAGGTTGACGACATCGCTGAGCGCTGTCTGGAAGAAGAAAACGACCAGCGCC
TCAAGGATATTGGTCAGCAGCTCTACGCCTTTACGTCGAAAGGTAGCTACGGGAAATACTTCTCTCGCAA
GAACAACGTCAGCTTCCAGAACCAGTTCACTGTACTGGAGCTCGATGAACTGCAAGGGCGTAAGCACTTG
CGTCAGGTTGTACTGCTCCAGCTTATTTACCAGATCCAGCAAGAAGTATTCCTGGGTGAACGTAACCGCA
AGAAAGTCGTCATCGTGGATGAGGCCTGGGACCTGCTCAAAGAGGGCGAGGTCTCGGTCTTCATGGAACA
TGCCTACCGCAAATTCCGTAAGTACGGTGGCTCCGTTGTCATTGCAACGCAGTCCATCAACGACCTCTAT
GAGAACGCAGTGGGCCGCGCCATCGCGGAGAACTCGGCCAGCATGTACTTGCTCGGCCAAACCGAAGAAA
CCGTGGAATCTGTTAAACGTAGCGGTCGTCTGACCCTTTCAGAGGGCGGGTTCCACACCCTCAAGACGGT
ACACACCATCCAGGGCGTGTACTCAGAAATCTTTATCAAATCGAAGAGCGGCATGGGCGTCGGACGCTTG
ATAGTGGGCGACTTCCAGAAGCTGCTTTATTCGACCGATCCGGTGGACGTTAACGCCATCGACCAGTTTG
TGAAACAAGGCATGAGCATTCCTGAGGCAATCAAGGCCGTGATGCGAAGCCGTCAGCAGGCTGCATAA
 Primer design