SecReT4
Protein ID: 134044863
T4SS name [ID]Tra_F [585]
Gene symboltraA
Locus tagYpIP275_pIP1202_0106
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]76304..76687 [+]
Producttype IV conjugative transfer system protein TraA
Component typeTraA_F
UniProt IDA4IUW4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-06, Aligned region: 10..102
Protein Sequence: 127 a.a.     [Download]
>gi|134044863|ref|YP_001102170.1| type IV conjugative transfer system protein TraA [Yersinia pestis biovar Orientalis str. IP275]
MNANQLANASSKNNALFLFLGLMVVAFLLVPDQAHAGTGGTAFDDVWVTLKDWTQGTLGRIVAGAMILVG
VVGGIARQSLMAFAMGIGGGMGLYNSPTVVESIMSATLEHAEKVIPAVVQLSNGLGV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|134044743|ref|NC_009141.1|:76304-76687 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGAACGCAAATCAGTTGGCGAATGCCTCAAGTAAAAACAACGCACTCTTCCTCTTCCTGGGGTTGATGG
TGGTAGCCTTCCTGCTCGTGCCGGATCAGGCCCACGCTGGTACTGGTGGTACAGCGTTTGACGACGTATG
GGTAACTCTCAAGGATTGGACCCAAGGTACTTTGGGTCGAATCGTTGCGGGTGCGATGATCCTGGTCGGT
GTTGTTGGTGGTATCGCTCGCCAGAGCCTCATGGCTTTCGCTATGGGTATCGGTGGCGGTATGGGCCTGT
ACAACTCCCCGACCGTAGTGGAATCCATCATGTCTGCTACTCTGGAACATGCAGAGAAGGTCATCCCGGC
TGTTGTGCAACTCAGCAATGGCCTGGGGGTGTAA
 Primer design