SecReT4
Protein ID: 134044883
T4SS name [ID]Tra_F [585]
Gene symboltraL
Locus tagYpIP275_pIP1202_0101
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]72598..72879 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA4IUV9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|134044883|ref|YP_001102165.1| type IV conjugative transfer system protein TraL [Yersinia pestis biovar Orientalis str. IP275]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|134044743|ref|NC_009141.1|:72598-72879 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCCCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAATCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design