SecReT4
Protein ID: 134044897
T4SS name [ID]Tra_F [585]
Gene symboltraD
Locus tagYpIP275_pIP1202_0094
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]67201..69066 [+]
Producttype IV conjugative transfer system protein TraD
Component typeTraD_F
UniProt IDA4IUV2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3e-19, Aligned region: 173..549
TrwB_AAD_bind [PF10412], Evalue: 2.7e-17, Aligned region: 167..211
TrwB_AAD_bind [PF10412], Evalue: 2.7e-17, Aligned region: 469..609
TraG-D_C [PF12696], Evalue: 4.1e-13, Aligned region: 471..595
DUF87 [PF01935], Evalue: 1e-06, Aligned region: 173..211
FtsK_SpoIIIE [PF01580], Evalue: 1.2e-05, Aligned region: 168..211
Protein Sequence: 621 a.a.     [Download]
>gi|134044897|ref|YP_001102158.1| type IV conjugative transfer system protein TraD [Yersinia pestis biovar Orientalis str. IP275]
MTMSYDPLAYEMPWRPNYEKNAVAGWLAASGAALAVEQVSTMPPEPFYWMTGICGVMAMARLPKAIKLHL
LQKHLKGRDLEFISIAELQKYIKDTPDDMWLGSGFLWENRHAQRVFEILKRDWTSIVGRESTVKKVVRKI
QGKKKELPIGQPWIHGVEPKEEKLMQPLKHTEGHSLIVGTTGSGKTRMFDILISQAILRGEAVIIIDPKG
DKEMRDNARRACEAMGQPERFVSFHPAFPEESVRIDPLRNFTRVTEIASRLAALIPSEAGADPFKSFGWQ
ALNNIAQGLVITHDRPNLTKLRRFLEGGAAGLVIKAVQAYSERVMPDWEAEAAAYLEKAKNGSREKIAFA
LMKFYYDIIQPEHPNSDLEGLLSMFQHDQTHFSKMVANLLPIMNMLTSGELGPLLSPDSSDLSDERQITD
SAKIINNAQVAYLGLDSLTDNMVGSAMGSIFLSDLTAVAGDRYNYGVNNRPVNIFVDEAAEVINDPFIQL
LNKGRGAKLRLFVATQTFADFAARLGSKDKALQVLGNINNTFALRIVDGETQEYIADNLPKTRLKYVMRT
QGQNSDGKEPIMHGGNQGERLMEEEADLFPAQLLGMLPNLEYIAKISGGTIVKGRLPILTQ
 
Nucleotide Sequence: 1866 bp     [Download]
>gi|134044743|ref|NC_009141.1|:67201-69066 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGACAATGAGTTATGACCCGCTCGCCTACGAGATGCCGTGGCGGCCCAACTATGAAAAAAATGCTGTAG
CAGGCTGGCTTGCCGCCTCCGGCGCGGCTTTGGCCGTAGAGCAAGTCAGCACGATGCCGCCGGAGCCATT
CTATTGGATGACGGGGATCTGTGGCGTGATGGCGATGGCTCGTTTGCCCAAGGCTATCAAACTTCACCTG
CTCCAAAAGCATTTGAAGGGGCGTGATCTGGAGTTTATTTCCATTGCGGAGCTCCAAAAGTACATCAAGG
ACACGCCGGACGATATGTGGCTTGGTAGTGGGTTCCTGTGGGAAAACCGCCATGCCCAGCGCGTGTTTGA
GATCCTGAAACGCGACTGGACTTCCATCGTAGGGAGAGAGTCCACGGTCAAAAAGGTTGTCCGGAAGATA
CAGGGTAAGAAAAAGGAGCTGCCAATCGGCCAGCCCTGGATTCACGGGGTAGAGCCCAAAGAAGAGAAGC
TGATGCAGCCACTCAAGCACACTGAGGGGCATTCGCTGATCGTTGGGACCACCGGCTCGGGCAAGACCCG
TATGTTCGACATCCTGATTTCACAGGCCATTCTGCGTGGGGAAGCCGTGATCATCATAGACCCGAAAGGG
GATAAGGAGATGCGGGACAATGCCCGACGTGCCTGTGAAGCTATGGGGCAGCCGGAAAGATTCGTCTCAT
TTCATCCAGCATTCCCGGAAGAGTCGGTGCGTATCGACCCTCTGCGTAACTTCACCCGCGTGACTGAAAT
CGCAAGTCGTTTGGCAGCGTTGATCCCGTCCGAAGCAGGGGCCGACCCGTTCAAATCATTTGGATGGCAG
GCACTGAACAACATCGCTCAGGGCTTGGTCATCACTCATGATCGTCCCAACCTGACAAAGCTCCGCCGAT
TCCTTGAAGGTGGCGCTGCTGGCTTGGTCATCAAGGCCGTTCAGGCTTACTCAGAGCGAGTTATGCCCGA
CTGGGAGGCAGAAGCAGCGGCTTACTTGGAAAAAGCCAAAAACGGTTCGCGTGAGAAGATCGCTTTCGCG
TTGATGAAGTTCTACTACGACATCATCCAACCTGAGCACCCGAACTCTGACCTGGAAGGCTTGCTGTCGA
TGTTCCAGCACGACCAAACCCACTTCTCCAAGATGGTGGCGAACCTCCTGCCGATCATGAATATGCTGAC
GTCCGGGGAGCTAGGCCCTCTGCTGTCTCCAGACTCATCTGATCTGAGCGACGAACGCCAGATCACCGAT
TCCGCAAAAATCATCAACAACGCTCAAGTTGCTTATCTGGGGCTCGACTCCCTGACCGACAACATGGTTG
GTAGTGCTATGGGGTCCATCTTCCTGTCAGACCTGACAGCGGTTGCCGGTGACAGATACAACTACGGCGT
CAACAACAGACCCGTAAATATCTTTGTTGATGAGGCTGCCGAGGTGATCAACGACCCGTTCATCCAGCTC
CTGAACAAAGGTCGCGGTGCGAAACTTCGTCTTTTCGTTGCAACTCAGACTTTTGCTGACTTCGCAGCTC
GACTGGGTAGCAAAGACAAAGCGCTCCAGGTGTTGGGGAACATCAACAACACGTTTGCTCTGCGTATCGT
CGATGGTGAAACCCAGGAGTATATCGCGGATAACCTGCCGAAGACCCGGCTCAAGTACGTCATGCGGACT
CAAGGCCAGAACTCGGATGGCAAGGAGCCCATTATGCACGGAGGCAACCAAGGCGAGCGTTTGATGGAGG
AGGAAGCTGATCTGTTCCCAGCCCAGTTATTGGGAATGCTTCCGAACCTGGAATACATAGCCAAAATTTC
AGGCGGAACAATCGTAAAAGGCCGTCTGCCCATATTGACCCAGTAA
 Primer design