SecReT4
Protein ID: 134044901
T4SS name [ID]Tra_F [585]
Gene symboltraU
Locus tagYpIP275_pIP1202_0114
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]88471..89478 [+]
Producttype IV conjugative transfer system protein TraU
Component typeTraU_F
UniProt IDA4IUX2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.6e-70, Aligned region: 37..334
Protein Sequence: 335 a.a.     [Download]
>gi|134044901|ref|YP_001102178.1| type IV conjugative transfer system protein TraU [Yersinia pestis biovar Orientalis str. IP275]
MMQKILRVIAVSAVFWVRSVSADPGCQNAEVIGGKLITDICWSCIFPIKVAGVPISGGGGSFPSEAVSNP
LCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGCSSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHY
YAFPLLVMLDLFIKQTCNADGYMDLDIMYMSELDPTWNNDELAFFTNPEAAAVANPIAAAACTADAVSST
AGKPLKQLFWCAGSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTL
PKTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|134044743|ref|NC_009141.1|:88471-89478 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGATGCAAAAAATTCTACGGGTCATTGCCGTTAGCGCGGTCTTTTGGGTTCGTTCGGTATCGGCTGACC
CTGGGTGCCAGAATGCGGAAGTAATCGGCGGAAAACTGATTACTGACATCTGCTGGAGCTGTATTTTTCC
CATCAAAGTAGCAGGGGTTCCTATAAGTGGTGGAGGCGGATCATTCCCGAGTGAAGCCGTAAGCAACCCT
CTGTGTATGTGCGAGGATAATCTAGGGGTCCCTCGGCCTGGAGTCACCACTTCTATGTGGGAGCCAGCAC
GGCTTGTTGAATTTCAGAGAGTGCCTGGCTGCTCATCTGTCTTGAATGGTGTCAGGTTCCCGTTTGATAG
GACTAACCAAGGGCATCATGGCATGGGAGACATGGATGGTGGTGATGGTTCTTTTATGCACTATCACTAC
TATGCGTTTCCTCTGTTGGTGATGCTCGATTTATTTATTAAGCAGACCTGTAATGCTGATGGGTATATGG
ATCTCGACATCATGTACATGTCGGAGCTCGACCCGACCTGGAACAATGATGAGCTCGCTTTTTTTACCAA
TCCAGAGGCGGCGGCAGTAGCAAACCCAATTGCGGCGGCTGCGTGTACTGCTGATGCTGTCTCATCAACC
GCTGGAAAACCTTTAAAACAGCTTTTCTGGTGTGCTGGTTCATGGGGCACCCTGTATCCATTTAGTGGCA
ACCAGAATGGTGGAAAAGGTGTTATCCGCGATAGCAGTCTTCTTAGCACAAGGGTTCTGGCTGCTTTGCA
TCGCCGGGGGTTAGCGTGGAAGACAATGGGTTCTGAGGCTATGTGTAGAGGTGTTATTAGCCCAACACTA
CCCAAAACGCAGTACAAATTCACGCTATTGCATCCGGTTCCAGAGACAAACTCATCTCACGTAATTGGCG
AATCCACTCTTACGTGGGGTCTGGCGCGAACTATACCGGCAATTGGGCAAGACCCTATTTACACCATCTG
GCGATGGAATGATTGCTGTAACAATTGA
 Primer design