SecReT4
Protein ID: 134044917
T4SS name [ID]Tra_F [585]
Gene symboltraB
Locus tagYpIP275_pIP1202_0104
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]74400..75716 [+]
Producttype IV conjugative transfer system protein TraB
Component typeTraB_F
UniProt IDA4IUW2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-50, Aligned region: 225..427
Protein Sequence: 438 a.a.     [Download]
>gi|134044917|ref|YP_001102168.1| type IV conjugative transfer system protein TraB [Yersinia pestis biovar Orientalis str. IP275]
MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGRQETIKHVLTDKNTREIGIDSLSADV
KMVSRENSDLKKELERVKKELEETKTTAGKSSDVGREMTRLRQDLDRLTQKNMELAKKVETGAAGGKTSS
SSEDARADVNGASGGDGQFMEKKLDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKPGIQIVSYSQKA
PEVEEKDNKDDESIYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIV
SGYGDLSSERAYLRGETFSCVRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKSLMAGFLGGVS
EAFDVNPVPVVSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFYIDMAEGIFPVIEVDAGRQVDI
IVTKGTKLQIRSTGGTKK
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|134044743|ref|NC_009141.1|:74400-75716 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGATTAAGCGATTTTGGACACAGTTAGACCCCAACAAGAAGCGTTGGGTGTCTATCGCTGGCGGCGTCT
TCGTTCTTTTTGCGGTCGTGACAATGTTCTCTGGTGAACCCAAGAAAGAAGAGAAGCGCGGTCGCCAAGA
AACCATCAAGCACGTTCTCACAGACAAAAACACCCGTGAGATCGGGATAGATTCGTTGTCTGCCGATGTG
AAGATGGTGTCTCGTGAAAACTCCGACCTGAAAAAGGAGCTGGAACGAGTCAAGAAAGAGCTGGAGGAAA
CCAAAACCACTGCCGGGAAATCCAGTGATGTTGGCCGTGAGATGACCCGCCTTCGTCAAGATTTGGACCG
CCTGACCCAGAAGAACATGGAATTGGCTAAGAAAGTCGAAACCGGCGCTGCTGGTGGAAAAACATCCTCT
TCATCAGAGGATGCCAGAGCCGATGTTAATGGTGCATCTGGTGGTGATGGTCAGTTCATGGAGAAAAAGC
TCGACTACAAAGATCCAGCATCCTTTTTTCGGGACGCACCGCTTCCTGACTCGAAGGGTGGGGCTCCTGC
AACTGGCAAGGGAGACGGTCGTGATGCAACTAAACCAGGCATCCAAATAGTGAGCTACTCGCAGAAAGCG
CCAGAAGTTGAAGAGAAGGACAACAAGGATGATGAGTCTATCTACCTACCTTCTGGCTCCATCCTGACAG
GGGTGCTCATCAACGGTATGGACGCACCAACATCTCAAGGTGCTCGTCGAGATCCGTTCCCTTCGACCCT
CAGGATTCAGAAAGAGGCTATTTTGCCTAACCGCTTCCGTGCGGATGTTCGTGAGTGCTTCCTGATTGTT
TCAGGCTATGGAGATCTCAGTTCAGAGCGAGCGTACCTGCGTGGCGAGACCTTCTCGTGCGTTCGGGATG
ATGGGGGGGTCATAGAAGCGAAGCTGGATTCCTATGCAGTGGGTGAAGACGGTAAGGCCGGTGTCCGTGG
TCGCGTCGTATCGAAGCAGGGGCAAATCATCGCCAAGAGCTTGATGGCAGGCTTCCTTGGTGGCGTTTCC
GAAGCCTTTGACGTCAATCCTGTGCCGGTCGTCAGCACTAACCCTGGCTCAAATACCCAGTACCAGTCTG
TGTTCTCCGACCAGATGTTGCAGGGAGCAGCAGTGAAGGGGGCCAGTAAGGCGCTAGATCGCATCGCTCA
GTTCTATATCGACATGGCCGAAGGCATCTTCCCCGTTATCGAGGTCGATGCTGGCCGTCAGGTAGACATC
ATCGTGACCAAAGGAACCAAGCTACAAATTCGTTCCACCGGGGGAACCAAGAAATGA
 Primer design