SecReT4
Protein ID: 134044926
T4SS name [ID]Tra_F [585]
Gene symboltraH
Locus tagYpIP275_pIP1202_0212
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]172815..174248 [+]
Producttype IV conjugative transfer system protein TraH
Component typeTraH_F
UniProt IDA4IV66
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5e-103, Aligned region: 37..401
Protein Sequence: 477 a.a.     [Download]
>gi|134044926|ref|YP_001102272.1| type IV conjugative transfer system protein TraH [Yersinia pestis biovar Orientalis str. IP275]
MVTHKTLKRSLLALSVAASLVMAPTGAIAANGLQSQMDKLFNEMSNTTPPGVYESQRRGVLAGGRFTAKT
RIFDENLVSFAPPSWKAGCGGVDLFGGSLSFINADQIVQLLRAVAANAKGYAFQLALDNVFPDGAKWIEN
FQKKVQALNQHLGNSCQLAQGFVNDLTSGMDLKHKTDASITATTSGLYEDFFGSKQETSGKSPLEELKAN
KPDEYNKMIGNIVWKQLKSNNANTWFQYGDNTLLEAIMSLTGTVIIGDLVNDPNSTGTGAKTTPLTTLPG
NKITLSDLISGGSVEIYSCDSDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIYKYATNSGTLT
DPEKAFVSNLPGGIGTIVRNLSVLSQDGANLFATESSGAIALTMMYSFSEEFFRAARIAMANSKSPYKKE
ALELLAQSQQQIRAEYTILSSQYGDLASQIEKYNNLLDNIRKQKYMLATLSNPPSTN
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|134044743|ref|NC_009141.1|:172815-174248 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGGTCACGCACAAGACATTAAAAAGGAGCCTGCTTGCCCTGAGTGTGGCGGCCAGTCTCGTCATGGCAC
CGACAGGGGCGATAGCCGCTAACGGCCTCCAATCACAGATGGACAAACTCTTCAATGAAATGAGCAACAC
AACACCACCTGGGGTTTATGAAAGCCAACGACGTGGCGTTTTAGCTGGTGGCCGGTTCACTGCAAAGACA
CGAATCTTCGACGAGAACCTGGTGAGCTTTGCCCCTCCATCATGGAAAGCTGGTTGCGGTGGTGTAGATC
TGTTCGGCGGTTCGCTTTCCTTCATTAACGCGGATCAAATTGTCCAACTCCTTCGGGCTGTAGCAGCCAA
CGCCAAGGGCTATGCCTTCCAGCTTGCGCTCGATAACGTTTTCCCGGACGGAGCGAAGTGGATAGAGAAC
TTCCAGAAGAAAGTGCAAGCGCTCAACCAACATCTGGGCAACTCCTGCCAGCTCGCTCAAGGTTTCGTGA
ACGACCTAACCAGCGGCATGGACCTTAAACACAAAACTGATGCTTCTATAACCGCGACAACTTCCGGCCT
GTATGAAGACTTCTTCGGGTCCAAGCAGGAAACCAGCGGCAAGAGTCCTCTGGAAGAACTGAAAGCCAAC
AAACCTGACGAATACAACAAGATGATTGGCAACATCGTCTGGAAGCAACTCAAGAGCAACAACGCCAACA
CCTGGTTCCAGTACGGGGATAACACCCTTCTTGAAGCGATCATGTCTTTAACCGGCACAGTCATCATTGG
TGATCTGGTAAACGACCCGAACTCAACCGGCACTGGTGCGAAAACAACCCCTCTGACGACCCTACCAGGT
AACAAGATCACCTTGTCAGACCTGATTTCAGGCGGTTCTGTTGAGATCTATTCCTGTGATTCTGATACGA
CCAACTGCCTGAGTGCTGGCTCCAGCAATAAAACTGTCGTGCTCAAAGGTATCAAGAACCAGATCACCGA
TATGCTGTTAGGAACAAGCTCTACACCTGGTGTGATCTACAAATACGCAACGAACTCTGGAACCTTAACC
GACCCAGAAAAGGCCTTTGTTTCTAACCTCCCCGGAGGGATTGGCACCATTGTTCGTAACTTGTCTGTCC
TTTCACAGGACGGCGCTAACCTGTTCGCAACAGAGTCATCAGGAGCGATAGCCCTGACCATGATGTATAG
CTTCTCGGAAGAGTTCTTCCGCGCAGCTCGCATTGCGATGGCTAACAGCAAATCACCCTACAAGAAAGAG
GCACTAGAGCTTCTCGCGCAATCGCAACAGCAAATCCGTGCTGAATACACAATCCTGTCCTCTCAATACG
GCGATCTGGCAAGCCAAATTGAGAAATACAACAACCTACTGGACAACATCCGCAAGCAAAAATACATGCT
GGCAACTTTGTCCAATCCTCCTAGCACGAACTAA
 Primer design