SecReT4
Protein ID: 134047107
T4SS name [ID]Tra_F [586]
Gene symbol-
Locus tagSNSL254_pSN254_0075
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]55663..56580 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDA4IVF0
KEGG IDsee:SNSL254_p_0075
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.3e-22, Aligned region: 62..283
Protein Sequence: 305 a.a.     [Download]
>gi|134047107|ref|YP_001101954.1| hypothetical protein SNSL254_pSN254_0075 [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MKNNAKLSLLALSLALGTSMAYASDDIPVVPASVMKKDVPAPVTSGQSSHEVVGSMNENPLLTMKPGVNQ
IIPIAVGHPNRIVTPFSNPEIVSTSLTGATDNGQCGEVCIKENVVYVATDKQYPVTMFITEKGSEAQALS
LTMVPRRIPPREVFLKLDGGVGITGAFANTKAETWEQSQPYVETIRSVFRKIALGEVPQGYTLNRIPAGA
AVPSCAHPGVKVDFSKGQYMMGHHLNVFIGVALNVSDQPIEFKEALCGSWDVAAVTTWPLNVLEPGQKTE
IYVAKKQKRGLAPTSKRPSLLGGAQ
 
Nucleotide Sequence: 918 bp     [Download]
>gi|134047083|ref|NC_009140.1|:55663-56580 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGAAGAACAACGCTAAACTTTCGCTCCTGGCGCTGTCCTTGGCGCTTGGAACTTCAATGGCCTATGCCT
CGGATGACATTCCTGTTGTCCCGGCCAGTGTTATGAAAAAGGATGTTCCTGCCCCTGTGACGTCAGGACA
AAGCTCCCATGAGGTTGTGGGCAGCATGAATGAAAACCCCTTACTGACGATGAAGCCGGGGGTTAACCAG
ATCATCCCGATAGCCGTTGGTCATCCGAACCGAATCGTCACGCCTTTCAGCAATCCTGAGATCGTTTCAA
CATCTCTGACCGGGGCGACGGATAACGGCCAGTGTGGTGAGGTCTGCATCAAAGAGAATGTGGTCTATGT
CGCCACGGATAAGCAGTATCCGGTGACTATGTTCATTACTGAAAAAGGCTCGGAAGCCCAAGCTCTCAGC
CTGACGATGGTTCCCCGTCGTATTCCGCCCAGAGAAGTCTTTCTCAAGCTCGATGGTGGTGTAGGTATCA
CTGGTGCTTTTGCCAATACCAAGGCTGAGACCTGGGAACAGAGCCAGCCTTATGTCGAAACCATCCGGTC
GGTATTCCGCAAGATTGCTCTTGGTGAAGTCCCTCAAGGTTACACGTTGAACCGCATCCCTGCTGGTGCT
GCGGTGCCGAGCTGCGCTCATCCTGGGGTAAAGGTGGATTTCAGCAAGGGGCAATACATGATGGGCCACC
ACCTTAACGTGTTCATCGGTGTCGCCCTGAACGTCTCTGATCAGCCTATTGAGTTCAAAGAGGCGTTGTG
TGGGAGCTGGGATGTGGCTGCGGTGACTACGTGGCCGCTTAACGTGCTTGAGCCCGGCCAGAAGACGGAG
ATCTATGTGGCGAAGAAGCAGAAGCGTGGTCTCGCACCAACGTCTAAGCGTCCATCGCTGCTGGGAGGTG
CCCAATGA
 Primer design