SecReT4
Protein ID: 134047117
T4SS name [ID]Tra_F [586]
Gene symboltraH
Locus tagSNSL254_pSN254_0188
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]166376..167809 [+]
Producttype IV conjugative transfer system protein TraH
Component typeTraH_F
UniProt IDA4IVQ6
KEGG IDsee:SNSL254_p_0188
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5e-103, Aligned region: 37..401
Protein Sequence: 477 a.a.     [Download]
>gi|134047117|ref|YP_001102060.1| type IV conjugative transfer system protein TraH [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MVTHKTLKRSLLALSVAASLVMAPTGAIAANGLQSQMDKLFNEMSNTTPPGVYESQRRGVLAGGRFTAKT
RIFDENLVSFAPPSWKAGCGGVDLFGGSLSFINADQIVQLLRAVAANAKGYAFQLALDNVFPDGAKWIEN
FQKKVQALNQHLGNSCQLAQGFVNDLTSGMDLKHKTDASITATTSGLYEDFFGSKQETSGKSPLEELKAN
KPDEYNKMIGNIVWKQLKSNNANTWFQYGDNTLLEAIMSLTGTVIIGDLVNDPNSTGTGAKTTPLTTLPG
NKITLSDLISGGSVEIYSCDSDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIYKYATNSGTLT
DPEKAFVSNLPGGIGTIVRNLSVLSQDGANLFATESSGAIALTMMYSFSEEFFRAARIAMANSKSPYKKE
ALELLAQSQQQIRAEYTILSSQYGDLASQIEKYNNLLDNIRKQKYMLATLSNPPSTN
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|134047083|ref|NC_009140.1|:166376-167809 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGGTCACGCACAAGACATTAAAAAGGAGCCTGCTTGCCCTGAGTGTGGCGGCCAGTCTCGTCATGGCAC
CGACAGGGGCGATAGCCGCTAACGGCCTCCAATCACAGATGGACAAACTCTTCAATGAAATGAGCAACAC
AACACCACCTGGGGTTTATGAAAGCCAACGACGTGGCGTTTTAGCTGGTGGCCGGTTCACTGCAAAGACA
CGAATCTTCGACGAGAACCTGGTGAGCTTTGCCCCTCCATCATGGAAAGCTGGTTGCGGTGGTGTAGATC
TGTTCGGCGGTTCGCTTTCCTTCATTAACGCGGATCAAATTGTCCAACTCCTTCGGGCTGTAGCAGCCAA
CGCCAAGGGCTATGCCTTCCAGCTTGCGCTCGATAACGTTTTCCCGGACGGAGCGAAGTGGATAGAGAAC
TTCCAGAAGAAAGTGCAAGCGCTCAACCAACATCTGGGCAACTCCTGCCAGCTCGCTCAAGGTTTCGTGA
ACGACCTAACCAGCGGCATGGACCTTAAACACAAAACTGATGCTTCTATAACCGCGACAACTTCCGGCCT
GTATGAAGACTTCTTCGGGTCCAAGCAGGAAACCAGCGGCAAGAGTCCTCTGGAAGAACTGAAAGCCAAC
AAACCTGACGAATACAACAAGATGATTGGCAACATCGTCTGGAAGCAACTCAAGAGCAACAACGCCAACA
CCTGGTTCCAGTACGGGGATAACACCCTTCTTGAAGCGATCATGTCTTTAACCGGCACAGTCATCATTGG
TGATCTGGTAAACGACCCGAACTCAACCGGCACTGGTGCGAAAACAACCCCTCTGACGACCCTACCAGGT
AACAAGATCACCTTGTCAGACCTGATTTCAGGCGGTTCTGTTGAGATCTATTCCTGTGATTCTGATACGA
CCAACTGCCTGAGTGCTGGCTCCAGCAATAAAACTGTCGTGCTCAAAGGTATCAAGAACCAGATCACCGA
TATGCTGTTAGGAACAAGCTCTACACCTGGTGTGATCTACAAATACGCAACGAACTCTGGAACCTTAACC
GACCCAGAAAAGGCCTTTGTTTCTAACCTCCCCGGAGGGATTGGCACCATTGTTCGTAACTTGTCTGTCC
TTTCACAGGACGGCGCTAACCTGTTCGCAACAGAGTCATCAGGAGCGATAGCCCTGACCATGATGTATAG
CTTCTCGGAAGAGTTCTTCCGCGCAGCTCGCATTGCGATGGCTAACAGCAAATCACCCTACAAGAAAGAG
GCACTAGAGCTTCTCGCGCAATCGCAACAGCAAATCCGTGCTGAATACACAATCCTGTCCTCTCAATACG
GCGATCTGGCAAGCCAAATTGAGAAATACAACAACCTACTGGACAACATCCGCAAGCAAAAATACATGCT
GGCAACTTTGTCCAATCCTCCTAGCACGAACTAA
 Primer design