SecReT4
Protein ID: 134047118
T4SS name [ID]Tra_F [586]
Gene symboltraA
Locus tagSNSL254_pSN254_0078
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]58481..58864 [+]
Producttype IV conjugative transfer system protein TraA
Component typeTraA_F
UniProt IDA4IVF3
KEGG IDsee:SNSL254_p_0078
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-06, Aligned region: 10..102
Protein Sequence: 127 a.a.     [Download]
>gi|134047118|ref|YP_001101957.1| type IV conjugative transfer system protein TraA [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MNANQLANASSKNNALFLFLGLMVVAFLLVPDQAHAGTGGTAFDDVWVTLKDWTQGTLGRIVAGAMILVG
VVGGIARQSLMAFAMGIGGGMGLYNSPTVVESIMSATLEHAEKVIPAVVQLSNGLGV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|134047083|ref|NC_009140.1|:58481-58864 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGAACGCAAATCAGTTGGCGAATGCCTCAAGTAAAAACAACGCACTCTTCCTCTTCCTGGGGTTGATGG
TGGTAGCCTTCCTGCTCGTGCCGGATCAGGCCCACGCTGGTACTGGTGGTACAGCGTTTGACGACGTATG
GGTAACTCTCAAGGATTGGACCCAAGGTACTTTGGGTCGAATCGTTGCGGGTGCGATGATCCTGGTCGGT
GTTGTTGGTGGTATCGCTCGCCAGAGCCTCATGGCTTTCGCTATGGGTATCGGTGGCGGTATGGGCCTGT
ACAACTCCCCGACCGTAGTGGAATCCATCATGTCTGCTACTCTGGAACATGCAGAGAAGGTCATCCCGGC
TGTTGTGCAACTCAGCAATGGCCTGGGGGTGTAA
 Primer design