SecReT4
Protein ID: 134047133
T4SS name [ID]Tra_F [586]
Gene symboltraN
Locus tagSNSL254_pSN254_0101
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]87842..90637 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA4IVH1
KEGG IDsee:SNSL254_p_0101
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.6e-56, Aligned region: 424..681
TraN [PF06986], Evalue: 2.6e-56, Aligned region: 766..841
Protein Sequence: 931 a.a.     [Download]
>gi|134047133|ref|YP_001101975.1| conjugal transfer mating pair stabilization protein TraN [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MRSHNYFMKAVASLLTVTMSALPIHSYANGSQDQDITAVGKEAQAFGQNLSNSFKSSSGTVQDGTISMPT
LKDGQFQMNGGSQINVNDLFPGTSGTNNKPDSYYFPDANKPDVGGLQGIYDSGDDMDSVGNNAKGSLWSD
ANSANPSISGAAYKVLLDASNRSRPDFSNDPVLNLSKKTYEDMDLIAGGFGDCSAETTINQNTINAHIPE
YERCQRVVDQSADCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGDNYWSGNCKIYEEYTRVQVS
NPDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWERNPNVDVTPYFKNVK
DGDVVTFKIRVSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMDSAKGVVDGFAEGEITCIDDPTDATG
CTVINGIKVCESQLKPSPLPGIPKLCKKVRVKADYDFYKGQMDCWTDPQGETHCPVNTGGNLDSCQKYEE
NPQCGFISSKCVDGAQGSSGTCYVHEDTYDCGTDVSVPTLEKETEYQCGGPIRCMGDDCLDLTKTQSTDF
ARATALLNAAQFMTQDMSCTGQDGDDNPTGDENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLN
LIMAVPKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQPVEQFVDQLID
QLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTAMTIYTVYVVAMVMIQMIYKCE
EEEFTMNAKRALKNCTYVGSYCKSKVLGACIEKREAYCCFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEG
IPLDKIAEIDWSKINLDEWLGILQQNGKFPDPASINLDSLTGAGNDFNIDGTRKNAQERALERLEGIDID
AKRKEATNSIDPQTGAPTGGG
 
Nucleotide Sequence: 2796 bp     [Download]
>gi|134047083|ref|NC_009140.1|:87842-90637 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGCGAAGTCATAATTACTTTATGAAAGCTGTGGCCTCGCTGTTGACAGTAACCATGTCTGCGCTGCCGA
TACATTCCTACGCTAACGGTAGCCAAGACCAGGACATCACAGCGGTGGGTAAAGAGGCCCAGGCTTTCGG
ACAAAACCTCTCAAACTCATTCAAGTCGAGCTCGGGGACTGTGCAAGATGGCACAATCTCTATGCCGACG
TTGAAAGACGGTCAATTCCAAATGAACGGGGGGAGTCAGATTAATGTCAATGATCTATTCCCCGGAACGA
GCGGGACCAACAATAAACCTGATAGTTATTACTTCCCTGATGCCAATAAACCTGATGTGGGCGGTCTGCA
AGGCATTTACGACTCTGGCGATGACATGGACAGCGTGGGGAATAATGCAAAAGGGTCGCTGTGGAGTGAT
GCCAATAGTGCTAATCCATCAATCTCTGGTGCGGCATACAAGGTTCTTCTCGATGCCTCTAATCGATCAC
GCCCTGATTTCAGTAATGACCCGGTACTAAATCTAAGCAAAAAGACCTATGAGGATATGGACCTCATCGC
AGGTGGCTTTGGGGATTGTTCTGCCGAAACAACCATCAATCAGAATACTATCAACGCCCACATTCCAGAG
TATGAACGGTGTCAGCGTGTTGTAGATCAAAGCGCGGACTGTGAGGTTGTCCATGACTACGACGCCTCTG
TGGTGAAGCACTATGATGGTCCATATAACCTCAAATCTTGTGGAGAAGGCTGTACTGAGTTGTGGATTGG
TCGAGTGGGGGACAACTACTGGAGTGGTAACTGCAAGATTTATGAGGAGTACACGCGGGTCCAAGTCAGC
AATCCAGATGCCATAGTGTCTGCAACGCTTGAATACGCCAAGTGGGATGACTACATGCAAGTGTGGGTCG
GTAAGTCCGGCCAAGAGACTAAAGTGTGGTCTGGCCCAGATGGCAACTTCCCTCCAGAAACAGCCGGTAG
ATGTGAGCTCTCCACGAGTTGGGAGCGAAACCCTAATGTTGATGTCACTCCCTATTTTAAGAACGTGAAA
GATGGTGATGTTGTTACGTTTAAGATCCGCGTTTCAGTAAGTGGCGAAGGTGAGGGTTTTGGCCGCATAA
AACTCCGCTATGACCCATCGAAAGCCATTACCAAGGATGAGTGGGCTCCACAGAGCTGCATGGATTCAGC
CAAAGGGGTGGTAGATGGTTTTGCGGAAGGCGAGATCACATGTATAGATGACCCGACTGATGCTACTGGC
TGCACAGTCATCAATGGGATCAAAGTTTGCGAATCTCAACTCAAGCCGTCACCTTTGCCTGGTATTCCAA
AACTATGCAAAAAGGTTCGAGTTAAAGCTGACTATGACTTCTATAAGGGGCAAATGGACTGCTGGACAGA
CCCTCAAGGTGAAACGCACTGTCCGGTAAACACGGGCGGGAATCTCGATAGCTGTCAGAAATATGAAGAA
AACCCTCAGTGCGGCTTCATCAGTTCCAAATGTGTTGATGGTGCTCAGGGAAGTTCTGGTACGTGCTACG
TCCACGAGGATACTTATGACTGTGGTACAGATGTTTCTGTTCCGACCTTGGAAAAGGAAACTGAGTACCA
GTGCGGTGGGCCTATACGCTGCATGGGAGATGACTGCCTTGATTTGACCAAAACACAAAGCACTGATTTT
GCTCGCGCTACTGCGTTGCTCAATGCAGCCCAATTCATGACGCAGGATATGAGCTGCACAGGCCAAGATG
GGGATGACAATCCTACCGGGGATGAAAACGTTATTTGCTCTGCTTTTGCAGGGGAAGCTGGCGAATGCAA
GATAGCTGTTGGGGGAGTTTCTGATTGCTGTGAAAAGCCAACCAATATATCTCTTGCCGATTATCTGAAC
CTAATAATGGCCGTTCCAAAGCTCGATGGCGCAGTGATGGGGCTGACTGATGGTAATGCGCTTAAAGGTG
CTTATCAGGTACTTAGGGAACCTGCCCTTCAAGGGTGGACAGAAGTCACAAAACCGTTCACAAGTTATAT
AGAGAACGTTTCAGGTGCTGTTGATTCGTTCTTCCAGCCTGTAGAGCAGTTTGTTGATCAACTCATTGAC
CAGCTCAAAGAGCAAGTCAAAGAAGTGATGATGGATGTCATGAAATCAGCAGGCCAAGATGCAGCAACAG
AGCAGGCGGCTGCCGCAGCATCTGAACAAGCTGCCGAAGCAATGATGGAGACTGCGACAACATGGCTTAG
CACTGCCATGACGATATATACCGTCTATGTCGTTGCGATGGTGATGATCCAGATGATTTATAAGTGCGAG
GAAGAAGAGTTCACTATGAACGCAAAAAGAGCGCTCAAGAATTGCACCTATGTAGGCTCTTATTGTAAAT
CTAAGGTGTTGGGCGCTTGTATTGAAAAAAGAGAAGCGTATTGCTGCTTCAATTCTCCGCTCTCTCGTAT
TATACAAGAACAGGTTCGCCCTCAATTGGGGCAGAACTTTGGAGACCCCAAAAATCCTCAGTGTGAAGGG
ATTCCACTAGATAAAATTGCCGAAATTGATTGGAGCAAAATTAATTTGGATGAGTGGCTTGGGATATTAC
AGCAGAACGGTAAATTCCCTGATCCGGCCTCAATAAATCTCGACTCGCTGACTGGAGCAGGGAATGACTT
CAATATTGACGGGACGCGGAAGAATGCTCAGGAAAGGGCGTTGGAGCGGTTGGAAGGGATTGATATTGAC
GCGAAGCGAAAAGAGGCGACAAACAGCATAGACCCTCAAACAGGCGCGCCAACTGGTGGTGGATAA
 Primer design