SecReT4
Protein ID: 134047150
T4SS name [ID]Tra_F [586]
Gene symboltraB
Locus tagSNSL254_pSN254_0076
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]56577..57893 [+]
Producttype IV conjugative transfer system protein TraB
Component typeTraB_F
UniProt IDA4IVF1
KEGG IDsee:SNSL254_p_0076
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-50, Aligned region: 225..427
Protein Sequence: 438 a.a.     [Download]
>gi|134047150|ref|YP_001101955.1| type IV conjugative transfer system protein TraB [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGRQETIKHVLTDKNTREIGIDSLSADV
KMVSRENSDLKKELERVKKELEETKTTAGKSSDVGREMTRLRQDLDRLTQKNMELAKKVETGAAGGKTSS
SSEDARADVNGASGGDGQFMEKKLDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKPGIQIVSYSQKA
PEVEEKDNKDDESIYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIV
SGYGDLSSERAYLRGETFSCVRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKSLMAGFLGGVS
EAFDVNPVPVVSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFYIDMAEGIFPVIEVDAGRQVDI
IVTKGTKLQIRSTGGTKK
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|134047083|ref|NC_009140.1|:56577-57893 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGATTAAGCGATTTTGGACACAGTTAGACCCCAACAAGAAGCGTTGGGTGTCTATCGCTGGCGGCGTCT
TCGTTCTTTTTGCGGTCGTGACAATGTTCTCTGGTGAACCCAAGAAAGAAGAGAAGCGCGGTCGCCAAGA
AACCATCAAGCACGTTCTCACAGACAAAAACACCCGTGAGATCGGGATAGATTCGTTGTCTGCCGATGTG
AAGATGGTGTCTCGTGAAAACTCCGACCTGAAAAAGGAGCTGGAACGAGTCAAGAAAGAGCTGGAGGAAA
CCAAAACCACTGCCGGGAAATCCAGTGATGTTGGCCGTGAGATGACCCGCCTTCGTCAAGATTTGGACCG
CCTGACCCAGAAGAACATGGAATTGGCTAAGAAAGTCGAAACCGGCGCTGCTGGTGGAAAAACATCCTCT
TCATCAGAGGATGCCAGAGCCGATGTTAATGGTGCATCTGGTGGTGATGGTCAGTTCATGGAGAAAAAGC
TCGACTACAAAGATCCTGCATCCTTTTTTCGGGACGCACCGCTTCCTGACTCGAAGGGTGGGGCTCCTGC
AACTGGCAAGGGAGACGGTCGTGATGCAACTAAACCAGGCATCCAAATAGTGAGCTACTCGCAGAAAGCG
CCAGAAGTTGAAGAGAAGGACAACAAGGATGATGAGTCTATCTACCTACCTTCTGGCTCCATCCTGACAG
GGGTGCTCATCAACGGTATGGACGCACCAACATCTCAAGGTGCTCGTCGAGATCCGTTCCCTTCGACCCT
CAGGATTCAGAAAGAGGCTATTTTGCCTAACCGCTTCCGTGCGGATGTTCGTGAGTGCTTCCTGATTGTT
TCAGGCTATGGAGATCTCAGTTCAGAGCGAGCGTACCTGCGTGGCGAGACCTTCTCGTGCGTTCGGGATG
ATGGGGGTGTCATAGAAGCGAAGCTGGATTCCTATGCAGTGGGTGAAGACGGTAAGGCCGGTGTCCGTGG
TCGCGTCGTATCGAAGCAGGGGCAAATCATCGCCAAGAGCTTGATGGCAGGCTTCCTTGGTGGCGTTTCC
GAAGCCTTTGACGTCAATCCTGTGCCGGTCGTTAGCACTAACCCTGGCTCAAATACCCAGTACCAGTCTG
TGTTCTCCGACCAGATGTTGCAGGGAGCAGCAGTGAAGGGGGCCAGTAAGGCGCTAGATCGCATCGCTCA
GTTCTATATCGACATGGCCGAAGGCATCTTCCCTGTTATCGAGGTCGATGCTGGCCGTCAGGTAGACATC
ATCGTGACCAAAGGAACCAAGCTACAAATTCGTTCCACCGGGGGAACCAAGAAATGA
 Primer design