SecReT4
Protein ID: 134047157
T4SS name [ID]Tra_F [586]
Gene symboltraL
Locus tagSNSL254_pSN254_0073
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]54775..55056 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA4IVE8
KEGG IDsee:SNSL254_p_0073
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|134047157|ref|YP_001101952.1| type IV conjugative transfer system protein TraL [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|134047083|ref|NC_009140.1|:54775-55056 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCTCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAACCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design