SecReT4
Protein ID: 134047158
T4SS name [ID]Tra_F [586]
Gene symboltraI
Locus tagSNSL254_pSN254_0065
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]46409..49381 [+]
Producttype IV conjugative transfer system protein TraI
Component typeTraI_F
UniProt IDA4IVE0
KEGG IDsee:SNSL254_p_0065
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 2.1e-118, Aligned region: 46..357
Protein Sequence: 990 a.a.     [Download]
>gi|134047158|ref|YP_001101944.1| type IV conjugative transfer system protein TraI [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDA
FSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDA
PEQTTPAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILY
PDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDA
FELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVT
PQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQ
GKLYLEVNET
 
Nucleotide Sequence: 2973 bp     [Download]
>gi|134047083|ref|NC_009140.1|:46409-49381 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGCTGAAAGCCCTTAACAAGTTATTTGGTGGGCGAAGTGGAGTGATCGAGACCGCGCCGAGCGTCAGAG
TGTTGCCGCTTAAAGACGTGGAAGATGAAGAAATCCCTCGATACCCACCTTTTGCCAAGGGCCTGCCAGT
GGCCCCACTAGACAAGATACTGGCAACCCAAGCTGAACTGATTGAGAAAGTGCGGAACTCTCTCGGTTTC
ACTGTGGACGACTTCAACCGGCTTGTTTTGCCGGTGATCCAGCGGTATGCCGCGTTTGTTCACCTGTTGC
CAGCTTCCGAATCACACCACCACCGTGGCGCTGGTGGTCTGTTCCGACATGGGCTTGAAGTGGCCTTCTG
GGCAGCTCAGGCATCTGAGTCAGTTATCTTTTCCATCGAGGGGACGCCTCGTGAACGCCGTGACAATGAG
CCGCGTTGGAGACTGGCGAGCTGTTTCTCCGGGCTGCTGCATGATGTGGGTAAACCGCTCTCGGATGTGT
CCATTACGGACAAAGACGGGTCAATCACATGGAACCCGTATTCGGAGTCACTTCATGACTGGGCACACCG
TCACGAAATCGACCGTTACTTTATCCGGTGGCGCGACAAGCGACACAAAAGACATGAGCAATTCTCGCTG
CTGGCGGTGGATCGAATTATTCCGGCTGAGACTCGGGAGTTTCTGTCCAAGTCTGGCCCGTCCATCATGG
AAGCGATGCTGGAAGCTATCTCAGGAACCAGCGTCAATCAGCCTGTGACCAAGCTGATGCTTCGCGCTGA
CCAAGAGAGCGTCTCACGGGACCTTCGCCAGAGTCGTCTCGATGTGGACGAGTTCTCCTATGGTGTGCCT
GTCGAGCGGTACGTGTTCGATGCCATCCGCCGCCTGGTTAAAACCGGAAAATGGAAGGTCAATGAGCCAG
GCGCGAAAGTCTGGCACCTCAACCAAGGTGTATTCATTGCCTGGAAACAGCTTGGGGACCTTTATGACTT
GATCAGCCACGACAAGATCCCCGGTATTCCACGAGACCCTGACACACTGGCCGACATTCTCATCGAACGT
GGTTTTGCTGTACCAAACACGGTGCAGGAGAAGGGTGAACGTGCGTACTACCGCTACTGGGAAGTTTTGC
CTGAGATGCTCCAGGAGGCGGCGGGATCGGTGAAGATCTTGATGCTCCGACTCGAATCAAACGACCTGGT
GTTTACGACTGAGCCTCCTGCGGCTGTTGCTGCGGAAGTTGTTGGTGATGTTGAGGACGCTGAGATTGAG
TTCGTTGATCCTGAGGAAGTCGATGACGACCAAGAGGAAGATGTGTCAGCTCTGAACGATGACATGTTGG
CCGCAGAGCAGGAAGCAGAGAAAGCTCTAGCTGGTCTTGGCTTTGGTGATGCGATGGAGATGCTGAAAAG
CACCTCAGATGCTGTCGAGGAGAAACCAGAGCAAAAAGATGCTGGATCAACGGAATCATCTAAGCCTGAC
GCTGGCAAGAAGGGTAAGCCGCAGAGCAAACCGGGCAAAGCAAAACCGAAGAGTGATACAGAGAAACAAC
CCCACAAACCAGAGGCAAAAGAGGATTTGTCCCCTCAGGACATTGCCAAAAACGCACCACCTTTGGCAAA
CGACAATCCGTTACAAGCACTCAAGGATGTTGGGGGTGGACTGGGGGACATCGACTTTCCGTTTGACGCA
TTCAGCGCATCGGCAGAGACAGCCAGCACTGACGCAACAAACTCAGAAATCCCAGATGTGGCAATGCCCG
GAAAGCAAGAGAAGCAGCCAAAACAGGACTTCGTTCCACAAGAACAAAACTCCCTGCAGGGCGATGACTT
TCCAATGTTCGGTAGTTCTGATGAACCGCCATCATGGGCGATTGAGCCGCTCCCTATGCTGACTGACGCA
CCAGAACAAACAACACCAGCGCCAGCAATGCCACCTACGGACAAACCTAATCTGCATGAGAAAGACGCAA
AGACCTTACTCGTTGAGATGTTAGCCGGGTACGGAGAAGCATCGGCGTTGCTTGAACAAGCGATCATGCC
TGTTTTGGAAGGTAAAACGACGCTGGGCGAAGTCCTATGCCTGATGAAGGGTCAAGCCGTCATTTTGTAC
CCGGATGGCGCTCGGTCGCTGGGTGCGCCGTCAGAGGTTCTCTCGAAGCTGTCCCACGCCAACGCGATTG
TTCCAGACCCGATTATGCCAGGTCGCAAAGTTCGTGATTTCAGCGGAGTGAAGGCAATTGTACTGGCGGA
GCAGCTTTCAGATGCAGTCGTAGCGGCCATTAAGGATGCCGAGGCGTCAATGGGGGGATACCAGGATGCC
TTTGAGCTCGTCTCTCCCCCTGGCTTGGATGCAAGCAAGAATAAGTCTGCACCGAAACAACAAAGCCGAA
AAAAGGCGCAGCAGCAGAAGCCTGAGGTTAACGCCGGTAAACCCTCGCCTGAACAAAAGGCGAAAGGTAA
GGACTCCCAGCCACAGCAGAAGGAGAAGAAGGTCGATGTTACTTCTCCGGTTGAAGAGCCGCAGCGCCAG
CCGGTCCAAGAAAAACAGAACGTGGCTCGCCTTCCTAAGCGGGAGGTTCAACCAGTGGCTCCTGAGCCCA
AAGTTGAGCGTGAGAAGGAATTGGGACACGTCGAGGTGCGAGAAAGGGAAGAGCCAGAGGTTAGGGAGTT
TGAGCCGCCTAAGGCGAAAACAAACCCGAAAGACATCAACGCGGAAGATTTCTTGCCGTCTGGTGTTACG
CCTCAGAAAGCACTCCAGATGCTCAAGGACATGATCCAAAAACGCTCGGGCAGATGGCTCGTGACACCTG
TCCTGGAAGAGGATGGCTGCTTAGTAACCAGTGACAAAGCCTTCGACATGATTGCCGGTGAAAACATCGG
CATCAGCAAACACATCCTCTGCGGGATGCTGAGCCGGGCACAGAGACGGCCTTTGCTCAAGAAACGTCAG
GGAAAACTGTATTTAGAGGTAAATGAAACATGA
 Primer design