SecReT4
Protein ID: 134047203
T4SS name [ID]Tra_F [586]
Gene symboltraC
Locus tagSNSL254_pSN254_0095
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]81520..83967 [+]
Producttype IV conjugative transfer system protein TraC
Component typeTraC_F
UniProt IDA4IVG5
KEGG IDsee:SNSL254_p_0095
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.2e-58, Aligned region: 20..255
AAA_10 [PF12846], Evalue: 2e-54, Aligned region: 451..729
DUF87 [PF01935], Evalue: 5.1e-06, Aligned region: 452..587
Protein Sequence: 815 a.a.     [Download]
>gi|134047203|ref|YP_001101969.1| type IV conjugative transfer system protein TraC [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MIVTIKKKLEETLIPEHLRAAGIIPVLAYDEDDHVFLMDDHSAGFGFMCEPLCGADEKVQERMNGFLNQE
FPSKTTLQFVLFRSPDINQEMYRMMGLRDGFRHELLTSVIKERINFLQHHTTDRIFAKTNKGIYDNGLIQ
DLKLFVTCKVPIKNNNPTESELQQLAQLRTKVESSLQTVGLRPRTMTAVNYIRIMSTILNWGPDASWRHD
SVDWEMDKPICEQIFDYGTDVEVSKNGIRLGDYHAKVMSAKKLPDVFYFGDALTYAGDLSGGNSSIKENY
MVVTNVFFPEAESTKNTLERKRQFTVNQAYGPMLKFVPVLADKKESFDTLYESMKEGAKPVKITYSVVLF
APTKERVEAAAMAARNIWRESRFELMEDKFVALPMFLNCLPFCTDRDAVRDLFRYKTMTTEQAAVVLPVF
GEWKGTGTYHAALISRNGQLMSLSLHDSNTNKNLVIAAESGSGKSFLTNELIFSYLSEGAQVWVIDAGKS
YQKLSEMLNGDFVHFEEGTHVCLNPFELIQNYEDEEDAIVSLVCAMASAKGLLDEWQISALKQVLSRLWE
EKGKEMKVDDIAERCLEEENDQRLKDIGQQLYAFTSQGSYGKYFSRKNNVSFQNQFTVLELDELQGRKHL
RQVVLLQLIYQIQQEVFLGERNRKKVVIVDEAWDLLKEGEVSVFMEHAYRKFRKYGGSVVIATQSINDLY
ENAVGRAIAENSASMYLLGQTEETVESVKRSGRLTLSEGGFHTLKTVHTIQGVYSEIFIKSKSGMGVGRL
IVGDFQKLLYSTDPVDVNAIDQFVKQGMSIPEAIKAVMRSRRQAA
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|134047083|ref|NC_009140.1|:81520-83967 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGATCGTAACCATCAAAAAGAAACTCGAAGAAACGTTGATCCCGGAGCACTTGCGAGCTGCCGGGATTA
TTCCTGTCCTGGCCTATGACGAAGACGATCATGTCTTCCTTATGGATGATCACAGTGCAGGCTTTGGTTT
CATGTGTGAGCCCCTGTGTGGTGCCGATGAAAAAGTTCAGGAGCGAATGAACGGTTTCCTGAATCAGGAG
TTCCCGTCGAAGACTACGCTCCAGTTTGTCCTGTTCCGCTCCCCGGACATCAATCAGGAGATGTACCGGA
TGATGGGTTTGCGTGATGGCTTCCGTCACGAGCTGCTGACATCTGTTATCAAGGAACGGATTAACTTCCT
CCAGCACCACACGACAGATCGCATATTTGCCAAGACCAACAAAGGTATCTACGACAATGGCTTGATCCAA
GACCTCAAGCTGTTCGTTACGTGCAAAGTCCCCATCAAGAACAATAACCCGACTGAAAGCGAACTCCAGC
AGCTCGCACAGCTTCGCACGAAGGTCGAATCATCGCTTCAAACCGTTGGTCTGCGTCCTCGCACAATGAC
GGCGGTGAACTACATCCGGATCATGAGCACCATCCTGAATTGGGGGCCAGATGCTTCATGGCGACATGAC
TCTGTGGATTGGGAGATGGATAAGCCCATCTGCGAGCAAATCTTCGATTACGGCACCGACGTGGAAGTCA
GCAAGAATGGCATCAGGCTGGGTGACTACCACGCGAAAGTCATGTCAGCGAAAAAGCTGCCTGACGTTTT
CTACTTTGGTGATGCGTTGACCTATGCCGGGGATCTCAGCGGCGGCAATTCCAGCATCAAAGAAAACTAC
ATGGTCGTGACCAATGTTTTTTTCCCTGAGGCAGAAAGCACGAAAAACACTCTGGAGCGCAAACGCCAGT
TCACTGTAAACCAAGCCTACGGGCCGATGCTCAAATTCGTGCCGGTGCTGGCGGACAAGAAGGAGAGCTT
CGACACTCTCTATGAGTCCATGAAAGAGGGGGCTAAGCCAGTCAAGATCACCTACTCGGTGGTTTTATTT
GCTCCAACCAAAGAACGTGTTGAAGCGGCGGCGATGGCCGCACGAAACATCTGGCGTGAATCTCGGTTCG
AGCTGATGGAGGACAAGTTCGTTGCTCTGCCGATGTTCCTCAACTGCCTGCCATTCTGTACCGACCGGGA
TGCAGTGCGAGACCTATTCCGCTACAAGACCATGACAACCGAGCAGGCTGCTGTGGTCCTGCCGGTGTTT
GGGGAATGGAAGGGGACCGGGACCTATCATGCAGCGCTGATTTCCCGCAACGGCCAGCTCATGAGTCTGT
CTCTTCACGACAGTAATACCAACAAGAACCTGGTGATCGCAGCCGAATCCGGCTCGGGTAAATCGTTCCT
TACCAACGAACTGATTTTTTCCTACTTGTCCGAGGGGGCTCAGGTCTGGGTTATTGATGCCGGTAAGTCC
TACCAGAAGTTGTCGGAAATGCTCAATGGCGACTTCGTTCACTTTGAAGAAGGAACGCACGTCTGCCTCA
ACCCGTTTGAGCTCATACAGAACTACGAGGACGAAGAAGACGCGATAGTCAGCCTCGTTTGTGCGATGGC
TTCGGCTAAGGGCTTGCTGGATGAATGGCAAATCTCTGCGTTGAAACAGGTCCTTTCTCGCCTGTGGGAA
GAGAAAGGTAAAGAGATGAAGGTTGACGACATCGCTGAGCGCTGCCTGGAAGAAGAAAATGACCAGCGCC
TCAAGGATATTGGTCAGCAGCTCTACGCCTTTACGTCGCAGGGCAGCTACGGGAAATACTTCTCTCGCAA
GAACAACGTCAGCTTCCAGAACCAGTTCACTGTACTGGAGCTCGATGAACTGCAAGGGCGTAAGCACTTG
CGTCAGGTTGTACTACTCCAGCTTATTTACCAGATCCAGCAAGAAGTATTCCTGGGTGAACGTAACCGCA
AGAAAGTCGTCATCGTGGATGAGGCCTGGGACCTGCTCAAAGAGGGCGAGGTCTCGGTCTTCATGGAACA
TGCCTACCGCAAATTCCGTAAGTACGGTGGCTCCGTTGTCATTGCAACGCAGTCCATCAACGACCTCTAT
GAGAACGCAGTGGGCCGCGCCATCGCGGAGAACTCGGCCAGCATGTACTTGCTCGGCCAAACCGAAGAAA
CCGTGGAATCTGTTAAACGTAGCGGTCGTCTGACCCTTTCAGAGGGCGGGTTCCACACCCTCAAAACGGT
ACACACCATCCAAGGCGTGTACTCAGAAATCTTTATCAAATCGAAGAGCGGTATGGGCGTCGGTCGCTTG
ATAGTGGGCGACTTCCAGAAGCTACTTTATTCGACCGATCCGGTGGACGTTAACGCCATCGACCAGTTTG
TGAAACAAGGCATGAGCATACCTGAGGCAATCAAGGCCGTAATGCGAAGCCGTCGGCAGGCTGCATAA
 Primer design