SecReT4
Protein ID: 134047205
T4SS name [ID]Tra_F [586]
Gene symboltraE
Locus tagSNSL254_pSN254_0074
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]55053..55679 [+]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDA4IVE9
KEGG IDsee:SNSL254_p_0074
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.1e-11, Aligned region: 27..170
Protein Sequence: 208 a.a.     [Download]
>gi|134047205|ref|YP_001101953.1| type IV conjugative transfer system protein TraE [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MNLKKYLKTWEGTQTENKWGRIFQGGLIAIVFLLVVQVFSKETIVTIQPFTLTEEAWVTKSNASQSYKEA
WGFAFAQLLGNVTPGTVDFVKERITPLLSPSIYQDVIDAIEIQAQQIKNDRVTMRFEPRFVEYEPKSDKV
FVYGYSYVKGASSNEERSERSYEFAIKISNYAPVLDYIDTYVGKPRTKTVLEQLQRKEENRRKHEEQR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|134047083|ref|NC_009140.1|:55053-55679 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
TTGAACCTGAAAAAGTATCTCAAGACCTGGGAAGGGACCCAAACAGAAAATAAGTGGGGGCGAATCTTCC
AGGGTGGTCTTATTGCTATCGTTTTCCTGCTGGTGGTCCAAGTATTCAGCAAGGAAACCATCGTCACTAT
CCAGCCTTTCACGCTCACGGAAGAAGCCTGGGTGACGAAAAGTAACGCCTCTCAGTCCTATAAAGAGGCT
TGGGGTTTCGCTTTTGCTCAGCTCCTTGGCAATGTGACGCCAGGAACCGTTGACTTTGTGAAAGAACGGA
TCACCCCGCTTCTCTCCCCGAGCATCTATCAGGACGTGATTGATGCCATCGAAATTCAAGCTCAACAGAT
CAAGAACGACCGCGTAACCATGCGGTTTGAGCCGCGTTTTGTTGAGTACGAGCCCAAGAGCGACAAGGTG
TTTGTCTACGGATATTCCTACGTCAAAGGGGCTTCTTCTAACGAAGAGCGTAGCGAACGCTCCTACGAGT
TCGCCATCAAGATTTCAAACTACGCGCCCGTGCTGGACTACATCGACACCTATGTAGGAAAGCCACGCAC
CAAAACTGTTTTGGAGCAACTCCAGCGCAAAGAAGAAAACCGGAGAAAGCATGAAGAACAACGCTAA
 Primer design