SecReT4
Protein ID: 134047211
T4SS name [ID]Tra_F [586]
Gene symbol-
Locus tagSNSL254_pSN254_0192
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]172824..173357 [+]
Producttransglycosylase
Component typeOrf169_F
UniProt IDA4IVR0
KEGG IDsee:SNSL254_p_0192
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 177 a.a.     [Download]
>gi|134047211|ref|YP_001102064.1| transglycosylase [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MKNKAKALVLSAALLSSTANAIDLSGTIFDKAAKAYNLDPLLVYSVALAESASGRGNGSISPWPWTLRVP
GLPFYAKSEDQAKAKLAEFQQQYGRAIDVGFMQVSIRWNGHRVSSPADLLDPETNVMVGAEVLSEAIQSS
PNDLELGVGRYHAWEDEIRARNYGSRVLAIYRNLRDL
 
Nucleotide Sequence: 534 bp     [Download]
>gi|134047083|ref|NC_009140.1|:172824-173357 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGAAGAACAAAGCCAAGGCGCTAGTTCTGTCTGCGGCTCTCCTTTCATCAACAGCGAATGCTATTGACC
TGAGCGGAACCATCTTCGACAAAGCAGCGAAAGCATATAACCTCGACCCTCTTCTAGTGTATTCGGTCGC
ATTGGCCGAATCTGCATCAGGGAGAGGTAATGGCTCTATAAGTCCTTGGCCTTGGACGCTTCGCGTTCCT
GGGCTTCCTTTCTATGCTAAGTCGGAAGATCAGGCAAAGGCTAAGCTCGCTGAGTTTCAGCAGCAGTACG
GTCGTGCCATTGATGTCGGGTTTATGCAAGTGAGCATCCGGTGGAATGGTCATAGAGTTTCTTCTCCAGC
AGATCTTCTCGACCCAGAGACCAACGTCATGGTTGGGGCAGAGGTGCTATCAGAAGCCATTCAGTCATCT
CCAAATGACTTGGAGCTTGGCGTTGGCCGCTATCACGCCTGGGAAGACGAAATCCGAGCCAGAAACTATG
GTAGCCGAGTCTTGGCTATCTATCGCAACCTTCGTGATTTGTGA
 Primer design