SecReT4
Protein ID: 134047236
T4SS name [ID]Tra_F [586]
Gene symboltraD
Locus tagSNSL254_pSN254_0066
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]49378..51243 [+]
Producttype IV conjugative transfer system protein TraD
Component typeTraD_F
UniProt IDA4IVE1
KEGG IDsee:SNSL254_p_0066
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4e-19, Aligned region: 173..549
TrwB_AAD_bind [PF10412], Evalue: 2.7e-17, Aligned region: 167..211
TrwB_AAD_bind [PF10412], Evalue: 2.7e-17, Aligned region: 469..609
TraG-D_C [PF12696], Evalue: 4.1e-13, Aligned region: 471..595
DUF87 [PF01935], Evalue: 1.2e-06, Aligned region: 173..211
FtsK_SpoIIIE [PF01580], Evalue: 1.2e-05, Aligned region: 168..211
Protein Sequence: 621 a.a.     [Download]
>gi|134047236|ref|YP_001101945.1| type IV conjugative transfer system protein TraD [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MTMSYDPLAYEMPWRPNYEKNAVAGWLAASGAALAVEQVSTMPPEPFYWMTGICGVMAMARLPKAIKLHL
LQKHLKGRDLEFISIAELQKYIKDTPDDMWLGSGFLWENRHAQRVFEILKRDWTSIVGRESTVKKVVRKI
QGKKKELPIGQPWIHGVEPKEEKLMQPLKHTEGHSLIVGTTGSGKTRMFDILISQAILRGEAVIIIDPKG
DKEMRDNARRACEAMGQPERFVSFHPAFPEESVRIDPLRNFTRVTEIASRLAALIPSEAGADPFKSFGWQ
ALNNIAQGLVITHDRPNLTKLRRFLEGGAAGLVIKAVQAYSERVMPDWEAEAAAYLEKVKNGSREKIAFA
LMKFYYDIIQPEHPNSDLEGLLSMFQHDQTHFSKMVANLLPIMNMLTSGELGPLLSPDSSDLSDERQITD
SAKIINNAQVAYLGLDSLTDNMVGSAMGSIFLSDLTAVAGDRYNYGVNNRPVNIFVDEAAEVINDPFIQL
LNKGRGAKLRLFVATQTFADFAARLGSKDKALQVLGNINNTFALRIVDGETQEYIADNLPKTRLKYVMRT
QGQNSDGKEPIMHGGNQGERLMEEEADLFPAQLLGMLPNLEYIAKISGGTIVKGRLPILTQ
 
Nucleotide Sequence: 1866 bp     [Download]
>gi|134047083|ref|NC_009140.1|:49378-51243 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGACAATGAGTTATGACCCGCTCGCCTACGAGATGCCGTGGCGGCCCAACTATGAAAAAAATGCTGTAG
CAGGCTGGCTTGCCGCCTCCGGCGCGGCTTTGGCCGTAGAGCAAGTCAGCACGATGCCTCCGGAGCCCTT
CTATTGGATGACGGGGATCTGTGGCGTGATGGCGATGGCTCGTTTGCCAAAGGCTATCAAACTTCACCTG
CTCCAAAAGCATTTGAAGGGGCGTGATCTGGAGTTTATTTCTATTGCGGAGCTCCAAAAGTACATCAAGG
ACACGCCGGACGATATGTGGCTTGGTAGTGGGTTCCTGTGGGAAAACCGCCATGCCCAGCGCGTGTTTGA
GATCCTGAAACGCGACTGGACTTCCATCGTAGGGAGAGAGTCCACGGTCAAAAAGGTTGTCCGGAAGATA
CAGGGTAAGAAAAAGGAGCTGCCAATCGGCCAGCCCTGGATTCACGGGGTAGAACCCAAAGAAGAGAAGC
TGATGCAGCCACTCAAGCACACTGAGGGGCATTCGCTGATCGTTGGGACCACCGGCTCGGGCAAGACCCG
TATGTTCGACATCCTGATTTCACAGGCCATTCTGCGTGGGGAAGCCGTGATCATCATAGACCCGAAAGGG
GATAAGGAGATGCGGGACAATGCACGACGTGCCTGTGAAGCTATGGGGCAGCCGGAAAGATTCGTCTCAT
TTCATCCAGCATTCCCGGAAGAGTCGGTGCGTATCGACCCTCTGCGTAACTTCACCCGCGTGACTGAAAT
TGCAAGTCGTTTGGCAGCGTTGATCCCGTCCGAAGCAGGGGCCGACCCGTTCAAATCATTTGGATGGCAG
GCACTGAACAACATCGCTCAGGGCTTGGTCATCACTCATGATCGTCCCAACCTGACAAAGCTCCGCCGAT
TCCTTGAAGGTGGCGCTGCTGGCTTGGTCATCAAGGCCGTTCAGGCTTACTCAGAGCGAGTTATGCCCGA
CTGGGAGGCAGAAGCAGCGGCTTATTTGGAGAAAGTCAAAAACGGTTCGCGTGAGAAGATCGCTTTCGCG
TTGATGAAGTTCTACTACGACATCATCCAACCTGAGCACCCAAACTCTGATCTGGAAGGCTTGCTGTCGA
TGTTCCAGCACGACCAAACCCACTTCTCCAAGATGGTGGCGAACCTCCTGCCGATCATGAATATGCTGAC
GTCCGGGGAGCTAGGCCCTCTGCTGTCTCCAGACTCATCTGATCTGAGCGACGAACGCCAGATCACTGAT
TCCGCAAAAATCATCAACAACGCTCAAGTTGCTTATCTGGGGCTCGACTCCCTGACCGACAACATGGTTG
GTAGTGCTATGGGGTCCATCTTCCTGTCAGACCTGACAGCGGTTGCCGGTGACAGATACAACTACGGCGT
CAACAACAGACCCGTAAATATCTTTGTTGATGAGGCTGCTGAGGTGATCAACGACCCGTTCATCCAGCTC
CTGAACAAAGGTCGCGGTGCGAAACTTCGTCTTTTCGTTGCAACTCAGACTTTTGCTGACTTCGCAGCTC
GACTGGGTAGCAAAGACAAAGCGCTCCAAGTGTTGGGGAACATCAACAACACGTTTGCTCTGCGTATCGT
CGATGGTGAAACACAGGAGTATATCGCAGATAACTTGCCGAAGACCCGGCTCAAGTACGTCATGCGGACT
CAAGGCCAGAACTCGGATGGCAAGGAGCCCATTATGCACGGAGGCAACCAAGGCGAGCGTTTGATGGAGG
AGGAAGCTGATCTGTTCCCAGCCCAGTTATTGGGAATGCTTCCGAACCTGGAATACATAGCCAAAATTTC
AGGCGGAACAATCGTAAAAGGCCGTCTGCCCATATTGACCCAGTAA
 Primer design