SecReT4
Protein ID: 134047241
T4SS name [ID]Tra_F [586]
Gene symboltraV
Locus tagSNSL254_pSN254_0077
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]57890..58468 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDA4IVF2
KEGG IDsee:SNSL254_p_0077
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.8e-26, Aligned region: 48..163
Protein Sequence: 192 a.a.     [Download]
>gi|134047241|ref|YP_001101956.1| type IV conjugative transfer system protein TraV [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MKNLNILTRKGSSRGEAQKEQAVRSAKMLGVGAALLILSGCSTFNIGKDEYSCPGMPNGVQCMSARDVYA
ATNDGNVPRPMKPEEVEAKAEADGEGSSNVSANSSSSGDPVIDNYVAPRLPDRPIPIRTPAQVMRIWVAP
WEDTNGDLIVTGYVYTEIEPRRWVIGDGTPQSEPVLRPLQTVQHEPKSETTK
 
Nucleotide Sequence: 579 bp     [Download]
>gi|134047083|ref|NC_009140.1|:57890-58468 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGAAAAATTTGAACATTTTGACCAGAAAGGGCAGTTCCAGAGGCGAGGCTCAAAAGGAACAGGCAGTAA
GATCCGCAAAGATGTTGGGGGTGGGTGCAGCGCTACTTATTTTGTCGGGCTGTTCGACGTTCAACATCGG
CAAGGATGAGTATAGCTGTCCGGGAATGCCGAATGGTGTTCAGTGTATGTCAGCGCGAGACGTTTACGCC
GCAACCAATGACGGAAATGTCCCGCGTCCAATGAAACCAGAGGAAGTCGAGGCCAAAGCGGAAGCGGATG
GCGAAGGTTCCTCAAACGTTTCAGCGAACTCATCTAGCTCCGGAGACCCGGTGATTGACAACTATGTCGC
ACCGCGTCTTCCGGATCGCCCGATTCCAATTCGTACACCAGCACAGGTTATGCGGATTTGGGTAGCTCCC
TGGGAGGACACCAATGGTGATCTCATCGTGACAGGGTATGTCTATACCGAAATCGAACCGCGCAGGTGGG
TGATTGGGGATGGCACACCGCAAAGTGAGCCAGTTTTGAGACCGCTGCAAACGGTACAACACGAACCGAA
GTCTGAAACAACCAAATAG
 Primer design