SecReT4
Protein ID: 134047246
T4SS name [ID]Tra_F [586]
Gene symboltraG
Locus tagSNSL254_pSN254_0189
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]167822..171436 [+]
Producttype IV conjugative transfer system protein TraG
Component typeTraG_F
UniProt IDA4IVQ7
KEGG IDsee:SNSL254_p_0189
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.6e-104, Aligned region: 5..469
Protein Sequence: 1204 a.a.     [Download]
>gi|134047246|ref|YP_001102061.1| type IV conjugative transfer system protein TraG [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MGSFSIHSIGDSAFLEQILIAVSMITGTGDFEKMVSIGLLLGVLMICIQSVFQGAKQINLQQVLVGWILY
ACFFGPTTTVTIEDAYTGQVRVVANVPIGVGFAGGVISNVGYTITNLFETGYGVIVPNVTESHFSETLKL
LNDVRRRAYDTGVFTALNSANGGGYVDVRRSWNNYIRECTLTKVDLNLMSLDELMNRSTDSALRFNSQLY
GTRLYLSTANPDGADYTCTDGWVAISTATANLSSPVVVDALNSLLGIDTSTGDNALTKLTDSLQAMGATT
TSSIDYLKAAVLEPLYYEAAAGRYQDLQDYGSALMVNQAIQQRNTQWAAEQSMFMTVVRPMLTFFEGFIY
AITPIIAFIIVMGSFGLQLAGKYVQTILWIQLWMPVLSIINLFVHTAASNEMSSLSAGGLNSMYALSSTG
DVLQHWIATGGMLAAATPVISLFIVTGSTYAFTSLASRISGSDHVDEKMQTPDLLKQGPVMQSQPAYNHN
QFSGAIANGAESMISTFSLGSTLASGVSSAQALQSQKSEAFQSTLGRGFSDGVSQDQAYSRLSNVGRNVS
SQNTAQSQLINQQAKNFMDKFQVDDSHSDAVKGAFAMQAMGTLDVDEAASMLMPMVGKARAAMKAAAGVK
SNSTALVPAGGNGESGGGSDVLDIKAQAKGATESSTQDSSSWSASDVSQFMKGVSYSQTDSQALTNQLAQ
GFSRSGSESFKQTWGDSLSQNLSKSASELVSASDTFTTMSQLQNQMGSMTNTDFKTLGGAVAQTPAAMNQ
LNDYFRNAAPQSVKDEAASLQQRYQAYGMSPQVAQAAARMTAMTNSKNYEQGKELGGYQAALQAINTASG
RNGAFSGDAYGNNGIEGPNVQGLPGQVQGAVGSGPNIPTGFRENVAGMAGTNPASEAGQLPTNSPLVQNE
HAAGTSALHNQAQQTERNVSAPELKKAQDNLMNSLPEMSWSASAWGAWDNSSDWMGRRAEQAGGALIAGG
QAGADAFSRAMDQMRTMTPEQRDQFIAATQRGDQAVQEEFGWAGDAMVGMAKLGRNVMGAAASGYDAAKE
WLTGKSDLSEAAKGMSIEERGAFYAAALSSAAEAGGGAAQQFMNQYGDEFKETMQSIAQSRYGLTESQAA
VYAESFDTNEGRMNQAVQNLKMEYAERNPDGSPMMQGGQPVLSQQNEEFTDKLVNVLQNSTEAGDRSGSY
LTAVRGYNIANQRF
 
Nucleotide Sequence: 3615 bp     [Download]
>gi|134047083|ref|NC_009140.1|:167822-171436 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGGGATCTTTTTCAATCCACTCTATCGGTGACTCTGCTTTTCTGGAGCAAATCCTGATTGCAGTATCAA
TGATCACCGGCACCGGGGATTTCGAGAAGATGGTCAGTATTGGCCTGCTTCTTGGGGTCTTGATGATCTG
TATTCAGTCCGTCTTTCAGGGCGCAAAGCAAATCAACCTCCAGCAAGTGCTGGTAGGTTGGATTCTATAT
GCCTGTTTCTTCGGCCCAACCACAACTGTGACTATCGAGGACGCTTATACAGGGCAGGTTCGAGTCGTCG
CCAATGTCCCTATTGGGGTAGGCTTTGCTGGAGGTGTCATATCCAACGTGGGATACACCATCACCAATTT
GTTTGAAACTGGATATGGGGTAATCGTACCCAATGTCACGGAAAGCCACTTTTCCGAAACACTGAAACTG
TTGAATGACGTCAGACGGCGAGCCTATGACACAGGAGTTTTTACTGCGCTTAACTCAGCAAATGGAGGCG
GCTATGTTGACGTGAGGCGTTCCTGGAACAATTACATTCGGGAATGCACGTTAACCAAAGTCGATCTCAA
CCTAATGTCCCTTGATGAGTTGATGAACCGTTCAACTGACTCAGCTTTGCGATTCAACTCACAGCTCTAC
GGAACTAGGTTGTATTTGTCTACAGCAAACCCTGACGGCGCTGACTACACATGTACTGACGGATGGGTGG
CTATTAGCACTGCAACCGCCAACCTAAGCAGCCCGGTTGTTGTTGATGCTCTTAACAGCCTACTGGGTAT
TGACACGTCAACTGGAGACAACGCTCTAACGAAGCTGACCGATTCGCTTCAAGCGATGGGTGCCACAACT
ACGTCATCAATCGACTATCTGAAAGCCGCCGTTCTGGAGCCCCTCTATTATGAAGCCGCAGCAGGACGTT
ATCAGGACCTCCAGGATTATGGCTCTGCATTGATGGTCAACCAGGCTATTCAGCAACGGAACACACAGTG
GGCCGCAGAGCAGTCGATGTTCATGACCGTCGTCCGACCAATGCTGACGTTCTTTGAAGGCTTTATTTAT
GCTATAACCCCGATCATTGCTTTTATTATCGTGATGGGCAGCTTCGGCCTCCAGTTAGCCGGGAAATATG
TACAAACCATCCTCTGGATTCAGCTATGGATGCCAGTCCTCTCAATTATAAACCTGTTTGTTCATACCGC
CGCGTCAAATGAGATGTCTAGCCTCAGTGCTGGTGGTCTCAACTCCATGTACGCTCTTTCCTCAACTGGA
GATGTTCTGCAACACTGGATTGCAACCGGCGGCATGTTGGCTGCGGCCACTCCGGTGATTTCCCTGTTTA
TCGTCACAGGTAGCACCTACGCCTTCACCAGCTTGGCATCGAGAATAAGTGGTTCTGACCACGTTGACGA
AAAGATGCAAACGCCAGATCTACTCAAGCAAGGTCCGGTTATGCAAAGTCAGCCAGCGTACAATCACAAC
CAGTTCAGTGGTGCGATTGCAAACGGCGCAGAAAGCATGATCAGTACCTTCTCGCTTGGCTCCACCTTGG
CATCAGGCGTGAGCTCCGCACAGGCATTACAAAGTCAGAAATCGGAGGCTTTCCAAAGCACTCTTGGTCG
AGGTTTTTCTGATGGAGTAAGTCAGGATCAAGCCTATTCAAGACTCTCCAATGTCGGGCGCAACGTTTCG
TCGCAAAACACAGCTCAAAGCCAATTGATCAACCAGCAAGCCAAGAACTTCATGGATAAGTTCCAGGTGG
ATGATAGCCACTCTGATGCTGTCAAAGGTGCTTTTGCCATGCAGGCTATGGGCACACTCGATGTTGACGA
AGCTGCGTCCATGCTTATGCCTATGGTTGGCAAGGCCAGGGCAGCAATGAAGGCCGCTGCTGGTGTGAAA
TCAAACAGTACAGCCCTAGTTCCTGCTGGTGGTAATGGCGAATCAGGCGGCGGCAGTGATGTCCTGGACA
TCAAAGCGCAAGCGAAGGGAGCAACAGAGTCATCAACTCAAGACTCTTCAAGCTGGTCAGCGAGTGATGT
GTCCCAGTTCATGAAGGGTGTGAGCTATTCGCAAACCGATAGCCAGGCGTTGACAAATCAATTAGCGCAG
GGTTTCAGCCGTTCTGGAAGCGAGTCATTCAAGCAAACCTGGGGCGATAGCTTATCCCAGAACCTATCCA
AGTCCGCTTCTGAACTGGTGTCTGCATCGGACACCTTCACAACAATGAGTCAGCTCCAAAACCAAATGGG
CTCCATGACTAATACCGACTTTAAAACTCTCGGTGGTGCAGTAGCACAAACCCCTGCGGCCATGAACCAA
CTGAATGACTATTTCCGAAATGCCGCGCCGCAATCGGTTAAAGACGAGGCGGCTTCACTACAGCAAAGAT
ACCAAGCCTACGGAATGTCTCCTCAAGTGGCCCAGGCAGCAGCGCGAATGACAGCAATGACCAACTCCAA
AAATTACGAACAGGGTAAGGAGCTTGGCGGGTATCAAGCCGCACTACAGGCGATCAATACCGCGTCCGGT
CGCAACGGAGCATTTAGTGGTGATGCTTACGGAAATAACGGCATTGAAGGCCCGAATGTTCAAGGCCTAC
CAGGTCAGGTTCAAGGGGCTGTAGGCAGTGGACCTAACATCCCAACCGGATTCCGGGAGAATGTGGCTGG
GATGGCTGGAACTAATCCGGCATCAGAAGCTGGGCAGTTACCAACGAATAGCCCCCTTGTTCAAAATGAA
CATGCAGCCGGTACGTCAGCTCTTCATAACCAAGCACAGCAAACAGAGCGAAATGTATCTGCTCCTGAAC
TGAAAAAAGCCCAAGATAACCTTATGAACTCGCTTCCGGAAATGTCTTGGAGCGCTTCGGCGTGGGGAGC
GTGGGACAACTCCAGTGATTGGATGGGCCGCAGAGCTGAACAAGCAGGTGGAGCTCTCATTGCTGGTGGT
CAAGCTGGCGCTGATGCGTTCTCAAGAGCGATGGATCAAATGAGAACGATGACACCTGAACAACGCGACC
AATTCATCGCGGCCACTCAACGCGGCGACCAGGCCGTGCAAGAGGAGTTTGGCTGGGCCGGTGATGCGAT
GGTCGGTATGGCTAAACTTGGCCGCAACGTCATGGGAGCTGCTGCAAGCGGCTATGATGCAGCGAAGGAG
TGGTTAACTGGTAAATCTGATCTATCGGAAGCCGCTAAAGGGATGAGCATTGAGGAACGCGGCGCGTTCT
ATGCAGCAGCGCTATCCTCTGCCGCAGAAGCTGGTGGTGGAGCCGCGCAGCAGTTTATGAACCAGTACGG
TGATGAGTTCAAAGAAACGATGCAGTCTATCGCTCAAAGCCGTTATGGGCTGACTGAATCCCAAGCCGCT
GTTTATGCCGAATCGTTTGACACAAACGAAGGTCGCATGAACCAGGCTGTTCAGAATCTGAAAATGGAGT
ATGCAGAACGTAACCCGGATGGCTCACCGATGATGCAAGGAGGTCAGCCTGTTCTTTCTCAGCAAAACGA
AGAGTTTACGGACAAGCTGGTAAACGTATTGCAGAACTCGACGGAAGCTGGAGACCGTTCAGGTAGCTAT
TTGACTGCCGTCAGGGGGTACAACATAGCAAATCAAAGGTTCTAA
 Primer design