SecReT4
Protein ID: 134047249
T4SS name [ID]Tra_F [586]
Gene symboltraU
Locus tagSNSL254_pSN254_0100
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]86719..87726 [+]
Producttype IV conjugative transfer system protein TraU
Component typeTraU_F
UniProt IDA4IVH0
KEGG IDsee:SNSL254_p_0100
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.6e-70, Aligned region: 37..334
Protein Sequence: 335 a.a.     [Download]
>gi|134047249|ref|YP_001101974.1| type IV conjugative transfer system protein TraU [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MMQKILRIMAVSAVFWVGSVSADPGCQNAEVIGGKLITDICWSCIFPIKVAGVPISGGGGSFPSEAVSNP
LCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGCSSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHY
YAFPLLVMLDLFIKQTCNADGYMDLDIMYMSELDPTWNNDELAFFTNPEAAAVANPIAAAACTADAVSST
AGKPLKQLFWCAGSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTL
PKTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|134047083|ref|NC_009140.1|:86719-87726 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGATGCAAAAAATTCTACGGATCATGGCCGTTAGCGCGGTCTTTTGGGTTGGTTCGGTATCGGCTGACC
CTGGGTGCCAGAATGCGGAAGTGATCGGCGGAAAACTGATTACTGACATCTGCTGGAGCTGTATTTTCCC
TATCAAAGTAGCAGGGGTTCCTATAAGTGGTGGAGGCGGATCATTCCCGAGTGAAGCCGTAAGCAACCCT
CTGTGTATGTGCGAGGATAATCTAGGGGTCCCTCGGCCTGGAGTCACCACTTCTATGTGGGAGCCAGCAC
GGCTCGTTGAATTTCAGAGAGTGCCTGGCTGCTCATCAGTCTTGAATGGTGTCAGGTTCCCGTTTGATAG
GACTAACCAAGGGCATCATGGCATGGGAGACATGGATGGTGGTGATGGTTCTTTTATGCACTATCACTAC
TATGCGTTTCCTCTGTTGGTGATGCTCGATTTATTTATTAAGCAGACCTGTAATGCTGATGGGTATATGG
ATCTCGACATCATGTACATGTCGGAGCTCGACCCGACCTGGAACAATGATGAGCTCGCTTTTTTTACCAA
TCCAGAGGCGGCGGCAGTAGCAAACCCAATTGCGGCGGCTGCGTGTACTGCTGATGCTGTCTCATCAACC
GCTGGAAAACCTTTAAAACAGCTTTTCTGGTGTGCTGGTTCATGGGGCACCCTGTATCCATTTAGTGGCA
ACCAGAATGGTGGAAAAGGTGTTATCCGCGATAGCAGTCTTCTTAGCACAAGGGTTCTGGCTGCTTTGCA
TCGCCGGGGGTTAGCGTGGAAGACAATGGGTTCTGAGGCTATGTGTAGAGGCGTTATTAGCCCAACACTA
CCCAAAACGCAGTACAAATTCACGCTATTGCATCCGGTTCCAGAGACAAACTCATCTCACGTAATTGGCG
AATCCACTCTTACGTGGGGTCTGGCGCGAACTATACCGGCAATTGGGCAAGACCCTATTTACACCATCTG
GCGATGGAATGATTGCTGTAACAATTGA
 Primer design