SecReT4
Protein ID: 134047253
T4SS name [ID]Tra_F [586]
Gene symboltraF
Locus tagSNSL254_pSN254_0187
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]165346..166374 [+]
Producttype IV conjugative transfer system protein TraF
Component typeTraF_F
UniProt IDA4IVQ5
KEGG IDsee:SNSL254_p_0187
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.9e-68, Aligned region: 43..272
Protein Sequence: 342 a.a.     [Download]
>gi|134047253|ref|YP_001102059.1| type IV conjugative transfer system protein TraF [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPVAEAK
PTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELAVVGD
PFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEGFSII
PVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAKRNGW
VTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|134047083|ref|NC_009140.1|:165346-166374 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
GTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGCTGGGGGCATCAC
ACCAGGCTTGGGCTCAAGATGGCACAAGACCTGGTTTTTATGAGCGAAAGGAAGAGGGTTGGTTCTGGTA
CAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTGGCAGAAGCGAAG
CCTACACAGCCTAAGCCTGCTGCTCCGCTTCCGAGCGGCCCAGAAATGTTCTCAGCGGAATGGTTCCGGG
AAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTTGAAAACGTCAGGACGTTTCTCTA
CTTGCAACGATTTGCGATAGATCGCTCTGAACAATTTTCCGATGCTACAGAGCTGGCGGTCGTAGGTGAT
CCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAAGTTGATCGTGACGCTG
GTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGAACGCGTAGGGATATTCTTCTTCTACAAGTCCGA
CGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGATTCTCGATCATT
CCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCGATGAAGGCCATG
CCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCAGTTCGCTCCTAT
AGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAACGCAATGGTTGG
GTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAGCCGAACGCTTGG
CCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGACAACTTTGTGCC
ACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design