SecReT4
Protein ID: 134047266
T4SS name [ID]Tra_F [586]
Gene symboltraW
Locus tagSNSL254_pSN254_0098
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconplasmid pSN254 [GenBank: NC_009140] [Browse all T4SS(s) in this replicon]
Location [Strand]84789..86054 [+]
Producttype IV conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDA4IVG8
KEGG IDsee:SNSL254_p_0098
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.5e-26, Aligned region: 106..231
Protein Sequence: 421 a.a.     [Download]
>gi|134047266|ref|YP_001101972.1| type IV conjugative transfer system protein TraW [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MIRSLAAHIPCSKSVLVALMFSVAGGAYAQESPLTEQDKALIEQGKQIAQKAQKMEMPSLLQNQHMDEAQ
AEAKAFFKQLQTTNPTLKEMHRKQAEKGIYSDHRILVFASLSLGEQGLDDVLTAVSGQPDSVIVFRGIPE
GMNLGQGVKAIQALAAKKDPVPNIIINPTLFKTYNITAVPTIVMLEDEPLPGEQPNVVAQVSGLSDPVWL
AREVDNGEKGDLGVKGPVEKISEPDLIDVAKKRLANIDWEEKKKQAIERFWTKQNFNELPRAPKSRTREI
DPSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRPFTQAVVVFDPLDKKQMELLAKKLPEIKLE
PGVQRITYIATEFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHTPSVITARGKKFVVRELAEEGG
E
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|134047083|ref|NC_009140.1|:84789-86054 Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence
ATGATCAGATCATTGGCCGCGCATATCCCCTGTTCTAAGAGCGTTCTGGTGGCGTTGATGTTCTCTGTGG
CTGGCGGGGCATACGCTCAAGAGTCTCCGCTCACAGAGCAGGATAAGGCGCTTATTGAGCAAGGAAAGCA
AATTGCCCAAAAGGCCCAGAAGATGGAAATGCCATCTCTGTTGCAAAACCAACACATGGACGAGGCTCAG
GCCGAAGCCAAGGCATTTTTCAAGCAGCTCCAAACTACTAACCCAACGCTCAAGGAGATGCACCGGAAAC
AGGCTGAAAAGGGTATCTACTCTGACCATCGGATACTGGTTTTCGCCTCGTTGTCTCTTGGCGAACAGGG
GTTAGATGACGTCCTAACGGCGGTGTCAGGCCAGCCTGATTCTGTAATTGTGTTCCGTGGCATCCCGGAA
GGAATGAACTTGGGGCAGGGAGTTAAAGCTATTCAGGCGCTCGCGGCCAAAAAAGACCCAGTGCCGAACA
TCATCATCAACCCTACGTTGTTCAAAACGTACAACATCACAGCCGTTCCCACGATTGTGATGCTGGAGGA
TGAGCCGCTGCCTGGCGAACAACCAAACGTCGTCGCCCAGGTCTCCGGGTTGTCCGACCCGGTATGGTTG
GCTCGGGAAGTGGATAACGGAGAAAAAGGCGATCTCGGCGTTAAGGGGCCGGTGGAGAAAATCAGTGAGC
CAGACCTTATTGATGTTGCCAAGAAACGCCTTGCCAATATCGACTGGGAAGAGAAGAAGAAACAGGCTAT
AGAGCGCTTCTGGACCAAGCAGAATTTCAATGAGCTGCCAAGAGCGCCAAAATCTCGAACACGAGAAATT
GACCCTAGCGTCATGATCACCAGTGACATCAGCACTCCGGATGGCACTGTGTTCGCTCACGCGGGTGACG
TGATCAACCCATTGTGCGATCCGAAGGAAGTTTGCAAGCCTGGAACGCGGCCATTTACCCAAGCGGTCGT
AGTTTTCGACCCGCTGGACAAAAAGCAAATGGAACTACTCGCCAAGAAGCTGCCTGAAATCAAGCTGGAG
CCTGGCGTACAACGGATCACCTATATCGCCACAGAGTTCGACAAAGACAAAGGCTGGGATTCCTACAAGA
GTGTCACCGACAACTTTGACGCGCCGGTATATCTGCTGACGCCAGATCTGATTACCCGGTTCGAGCTGGA
GCACACACCGAGCGTCATTACTGCCAGAGGCAAGAAGTTTGTTGTCCGCGAACTTGCTGAGGAGGGCGGT
GAATGA
 Primer design