SecReT4
Protein ID: 134095192
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2000
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2010192..2010812 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA4G6K7
KEGG IDhar:HEAR2000
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|134095192|ref|YP_001100267.1| hypothetical protein HEAR2000 [Herminiimonas arsenicoxydans]
MFQDAELMCPSPPWFHHPERRLLAGVLGLLWSVLAGGCATTTAPPAPDAIEEVLATPEPEAPEYIPVVRY
GRYTLVELAPRAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYSLCQTAHAVIELYALPLPAAHLH
LGPMTLRDALLTLAGPAWELHADDRARQICFERPADSAVIEPASEPPAAEAVQTFPLEPSVSGGQP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2010192-2010812 Herminiimonas arsenicoxydans chromosome, complete genome
TTGTTTCAGGACGCCGAGCTTATGTGCCCCTCTCCACCTTGGTTTCACCATCCCGAACGCCGCCTGCTGG
CAGGAGTCCTCGGCCTGCTCTGGTCGGTGCTGGCTGGCGGCTGCGCTACGACGACTGCGCCGCCCGCACC
TGATGCCATCGAGGAAGTGTTGGCCACGCCCGAACCCGAGGCGCCCGAGTACATCCCCGTCGTGCGCTAC
GGTCGCTACACGCTGGTCGAGCTGGCACCCAGAGCGGCGCAACGCGACCTGCTGTTGCAGACCATCGACG
TGTCCATGCCCGAAGATGCCCGCGCCACCGTCGGCGATGGGCTGCGGCATGTGCTCAAGCGCAGCGGTTA
CAGCCTGTGCCAGACGGCGCACGCGGTAATCGAGCTGTACGCGCTGCCGCTGCCGGCGGCGCACCTGCAC
CTCGGCCCCATGACCTTGCGCGATGCGCTGCTCACACTGGCTGGCCCGGCCTGGGAACTGCACGCGGATG
ATCGCGCACGGCAGATTTGCTTCGAACGGCCCGCCGACAGCGCGGTCATCGAACCCGCATCCGAGCCACC
CGCCGCCGAGGCGGTGCAGACGTTCCCGCTGGAGCCTTCGGTTTCGGGAGGCCAGCCATGA
 Primer design