SecReT4
Protein ID: 134095194
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2002
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2011474..2012199 [+]
Productsignal peptide
Component typeTfc3
UniProt IDA4G6K9
KEGG IDhar:HEAR2002
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|134095194|ref|YP_001100269.1| signal peptide [Herminiimonas arsenicoxydans]
MNPSIILSALLLASAQLPAWAQQPVTAPARNAQNQERPLVARTPDDQVAGDWGLQPQEWALYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQIEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPS
GGAVRGGGRTAVFVKDGCAACGQLVQRLQSSGTEFDLYMVGSRQDDARIRDWAKRAQIDPTRVRSGTITL
NHDGGRWLSLGLPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2011474-2012199 Herminiimonas arsenicoxydans chromosome, complete genome
ATGAATCCGTCGATCATCCTTTCCGCGCTCCTGCTGGCATCCGCCCAATTGCCCGCCTGGGCGCAGCAGC
CGGTCACCGCCCCGGCCCGCAATGCGCAGAACCAGGAGCGTCCGCTGGTCGCCCGAACCCCGGACGACCA
GGTAGCAGGCGACTGGGGCCTCCAACCGCAGGAATGGGCGCTATACCGCGAGCTGATGGACGGGCCGCTG
GGCATCTATTCGCCTAACCTGGACCCTCTGTCCGCCCTGGGCATCGAGGCCCGCACCGACGAGGAACGGC
GGCGCTACGCAGAACTGCAGGTGCAAATCGAAGCGCGCCGCGTCGAGAAGCTGCTTGCCTATCAACGTGC
CTACGACGAAGCCTGGCAGCGCCTGAACCCCGGCATGCAACGGGTGAACCTGCCTGACGACAAACCCAGC
GGCGGCGCAGTGCGCGGCGGCGGCCGCACGGCGGTGTTCGTCAAGGACGGCTGCGCGGCCTGCGGACAGC
TCGTGCAACGCCTGCAATCCTCAGGTACCGAGTTCGACCTGTACATGGTCGGCAGCCGCCAGGACGACGC
GCGCATCCGCGACTGGGCCAAGCGCGCACAGATCGACCCGACACGGGTGCGCAGCGGCACCATCACGCTC
AACCACGACGGCGGCCGCTGGCTGTCGCTGGGTCTGCCCGGCGATCTGCCCGCGGTCGTGCGCGAGGTGA
ACGGCCAATGGCAGCGCCAGCCCTGA
 Primer design