SecReT4
Protein ID: 134095195
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2003
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2012181..2012771 [+]
Productsignal peptide
Component typeTfc4
UniProt IDA4G6L0
KEGG IDhar:HEAR2003
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|134095195|ref|YP_001100270.1| signal peptide [Herminiimonas arsenicoxydans]
MAAPALTARFRVLVIAAGLYACAVHAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRIVPWPWS
LNVAGQSRRYATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHKHRFTSPCDLLDPYRNLAIASEILKE
QHIPGENWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPTAAVLAARQETTP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2012181-2012771 Herminiimonas arsenicoxydans chromosome, complete genome
ATGGCAGCGCCAGCCCTGACGGCGCGGTTTCGCGTACTGGTGATCGCTGCTGGCCTGTACGCCTGCGCCG
TCCATGCCCAGGAGGTTCCGCCTCCGGCCTATCAGCTTGCCGCCCAACGTGCGGGCATTCCCTCCACGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGGCGGAACGGACGCATCGTCCCGTGGCCGTGGTCC
CTCAACGTCGCCGGCCAATCGCGCCGCTATGCGACCCGCGCCGACGCCTGCGCCGGTTTGCAGCAGGCGA
TGCGCTCCACGCCGCACACGCGCATCGACGCGGGCCTGGGTCAGATCAACCTCGGCTACCACAAGCACCG
CTTCACCAGCCCGTGCGACTTGCTCGATCCGTACCGCAACCTCGCCATCGCCTCCGAGATCCTGAAGGAG
CAGCACATCCCGGGGGAGAACTGGCTGCTGGCGATCGGCCGCTACCACCGCCCCGCGGGGGGCGAGCCCG
CAGCCCGCTACCGGCGGAGCGTTTCCCGCCACCTCGCCCGCGTGCAGGGCACGCGCCCAACCGCCGCGGT
CCTCGCCGCGCGCCAGGAGACCACCCCATGA
 Primer design