SecReT4
Protein ID: 134095196
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2004
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2012768..2013316 [+]
Productsignal peptide
Component typeTfc5
UniProt IDA4G6L1
KEGG IDhar:HEAR2004
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.1e-51, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|134095196|ref|YP_001100271.1| signal peptide [Herminiimonas arsenicoxydans]
MTKSHLAHLAAKGLLVLLAGLPLASRAGEPLILVEDRGGTSALPYYEALSLQPRANTPARSPIPATQIPA
TPADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVVGDDEASQAWLRRHAASLRERGAVGLVVNVETVQ
GLARLRALASGVPLAPVSGDDLAERLGLRHYPALVTATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2012768-2013316 Herminiimonas arsenicoxydans chromosome, complete genome
ATGACGAAATCCCATCTGGCCCATCTCGCGGCGAAAGGCCTGCTCGTGCTGCTGGCGGGTCTGCCGCTGG
CCTCGCGTGCCGGCGAGCCGCTGATCTTGGTCGAAGACCGTGGCGGCACGTCGGCGCTGCCGTACTACGA
AGCCCTGAGCCTCCAGCCGCGCGCCAACACTCCGGCCCGATCGCCCATCCCTGCGACTCAGATCCCGGCC
ACGCCGGCGGATGAGGCCGCGATGTTGCCGGTGCGCAGCGCCAAGCTCACGCCCGGCACCGTCGCGCGGC
GGGTGATCGAGGCCCCGGGCCTGCGTCCCTTCGTGGTCGTGGGCGACGACGAGGCTTCCCAGGCCTGGTT
GCGCCGCCATGCAGCCTCATTGCGCGAGCGCGGCGCGGTCGGTCTGGTGGTCAACGTCGAGACCGTGCAA
GGCCTGGCGCGGCTGCGCGCACTGGCGTCCGGCGTGCCGCTTGCGCCCGTGTCCGGCGACGACTTGGCCG
AGCGCTTGGGCCTGCGGCACTACCCGGCGCTAGTCACGGCCACCGGCATCGAGCAATGA
 Primer design