SecReT4
Protein ID: 134095198
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2006
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2015504..2016253 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA4G6L3
KEGG IDhar:HEAR2006
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|134095198|ref|YP_001100273.1| hypothetical protein HEAR2006 [Herminiimonas arsenicoxydans]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDEGWRHSQQMLQYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSHGQTRNFRYYISQAYVWTES
YLIAAAFTTLTFLVRLLVLVLTLPLILTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2015504-2016253 Herminiimonas arsenicoxydans chromosome, complete genome
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAAGGCCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTGGGGGTGCTGATCGGCTCGCTGCTGTTCTCCATTGTCGTGGAGTGCGTCGG
AATGCACCTGTTCTGGAAGGACGAGGGCTGGCGACACTCCCAGCAGATGTTGCAGTACGAGTTGGGGCAC
CTGTCCAACCACTTCACGCGCAGCGTGGTCGTGCAGGAACCGGGGCGCACGGCGCACGAGCTGGTGGATA
CCGGATACGAATGGGTGTTCGTGCGCTCGGGCTTGCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
TGCACCCAGCCACGGGCAGACACGCAACTTTCGCTACTACATCAGCCAGGCCTATGTCTGGACCGAGAGC
TACCTGATCGCCGCAGCCTTCACGACGCTGACCTTCCTTGTGCGCCTGCTGGTCCTGGTGCTCACGTTGC
CGCTGATCCTCACCGCGGCATTCGTCGGCCTGATCGACGGCCTAGTGCGGAGGGACGTGCGCCGGTTCGG
CGCGGGCCGCGAATCGGGCTTCATCTACCACCGCGCGAAAGCAAGCCTGATGCCGCTGGCCGTTCTGCCC
TGGGTCACGTACCTGGCCTTGCCGATCTCGGTGCATCCACTGCTGATTCTGCTGCCGAGCGCCGCCTTGC
TGGGGCTGGCCGTGAGCCTGACCGCGGGCAGCTTCAAGAAATACCTTTAG
 Primer design