SecReT4
Protein ID: 134095204
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2012
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2022030..2022410 [+]
Productsignal peptide
Component typeTfc9
UniProt IDA4G6L9
KEGG IDhar:HEAR2012
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2e-30, Aligned region: 30..109
Protein Sequence: 126 a.a.     [Download]
>gi|134095204|ref|YP_001100279.1| signal peptide [Herminiimonas arsenicoxydans]
MLAPIWLRAAHRGVPTFLVTALLLGQSPMALAEPPTQRQELVAALRQLDALERTVADSAAHAPIQPGERY
HFDYPRLLADLARVRAGIQAHLSPSRAQPRDPSELAGDYRTERAVEPSPTTAEVKP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2022030-2022410 Herminiimonas arsenicoxydans chromosome, complete genome
ATGTTGGCTCCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCCTGC
TGGGCCAGTCCCCGATGGCGTTGGCCGAGCCCCCCACGCAGCGCCAGGAACTGGTCGCGGCGCTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCCGACAGCGCCGCGCATGCCCCCATCCAGCCGGGAGAGCGCTAC
CACTTCGATTACCCGCGGCTGCTGGCTGACCTAGCGCGCGTGCGCGCCGGTATCCAGGCCCACCTCTCAC
CTTCGCGTGCCCAGCCGCGCGACCCCTCCGAACTGGCCGGCGACTACCGCACTGAGCGGGCCGTCGAGCC
ATCGCCGACGACCGCGGAGGTCAAGCCATGA
 Primer design