SecReT4
Protein ID: 134095207
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2015
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2023029..2023439 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA4G6M2
KEGG IDhar:HEAR2015
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.5e-49, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|134095207|ref|YP_001100282.1| hypothetical protein HEAR2015 [Herminiimonas arsenicoxydans]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIALAPTFVVLG
VAFGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRYPLVAGWVGGHVLISRSGFWTTRRSAARGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2023029-2023439 Herminiimonas arsenicoxydans chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCTGACGGGACGGTCACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTCGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGTGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCGCTCGCGCCCACGTTCGTCGTGCTGGGC
GTGGCCTTCGGCGTGTTCATCGGGGGCGGCATCCTGCGTCGCCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTATCGGCAACTCCAGTGGCGCATCGCCACGCGCTATCCGCTGGTGGCGGGCTGGGTGGGCGGCCATGT
GCTGATCTCACGCTCCGGCTTCTGGACCACCCGAAGGTCTGCTGCAAGGGGGGCACGATGA
 Primer design