SecReT4
Protein ID: 134095208
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2016
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2023436..2024125 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA4G6M3
KEGG IDhar:HEAR2016
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.7e-89, Aligned region: 6..206
Protein Sequence: 229 a.a.     [Download]
>gi|134095208|ref|YP_001100283.1| hypothetical protein HEAR2016 [Herminiimonas arsenicoxydans]
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYARNLHTLSPYLTPSCQAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRVVSDRDWVVTLDITADEYYGAEQVKRALVRYPVKVTRVDIDPARNPFGLALDCYEGAPQRISTPE
PSRPAPGGLSPQAPQGETP
 
Nucleotide Sequence: 690 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2023436-2024125 Herminiimonas arsenicoxydans chromosome, complete genome
ATGAGCCGCTTCAAGAACGAGATCACCCATCTGCAGGCGCACATCAAGACGCTTCGCCTGGGTGCTGGCG
CGCTGGTCATCGTCGCCCTGGTCATGGGCGGCGGCTGGTGGAGCGCTCCGCGCGACCTGACCATCCACGT
CCCGCCTGATCTGCGCTCCGGCAGTACCCGCAAGTGGTGGGAAGTGCCGCCCGAATCGGTCTATGCGTTC
ACGTTCTACGTGTTTCAGACCCTCAACCGCTGGCCGACGAATGGCGAAGAGGACTATGCGCGTAATCTCC
ACACGCTCTCGCCGTACCTCACCCCATCCTGCCAGGCCTTCCTGCGGGCGGACTACGACTATCGCCGCTC
CACGGGCGAGCTGCGTCAGCGCGTGCGCGGCATCTACGAAATCCCCGGTCGCGGCTACGGTGACGACCCC
ACGGCGCGCGTGCGCGTGGTGTCCGACCGCGACTGGGTGGTGACGCTGGACATCACCGCAGACGAGTACT
ACGGGGCGGAACAAGTCAAGCGGGCTTTGGTGCGCTACCCCGTGAAAGTCACGCGGGTGGACATCGATCC
CGCTCGCAATCCGTTTGGCCTGGCGCTCGACTGCTACGAGGGTGCGCCCCAGCGCATCAGCACACCGGAG
CCGTCGCGCCCGGCACCTGGCGGCCTGTCTCCGCAAGCGCCTCAAGGAGAAACCCCATGA
 Primer design