SecReT4
Protein ID: 134095209
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2017
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2024122..2025039 [+]
Productsignal peptide
Component typeTfc13
UniProt IDA4G6M4
KEGG IDhar:HEAR2017
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.2e-125, Aligned region: 7..287
Protein Sequence: 305 a.a.     [Download]
>gi|134095209|ref|YP_001100284.1| signal peptide [Herminiimonas arsenicoxydans]
MKHLVLALLGLLAVASAPFAQAVEILRWERMPLAVPLRVGQERVVFINRNVRVGVPAGVGERLRVQSAGG
AVYLRASEPIEPTRLQLQDADTGALILLDIAAEPAKDGEAELEPVRIVEGDSAPTRYGDQADGADDAPAR
AQDQAGARAARRETPVPVVLTRFAAQNLYAPLRTVEPLPGVMRVNLRRDLDLGTLVPTLPVRAVALASWR
LEDQWVTAVRLTNSSGGWITLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGHGLAQSLLPAIN
RFDPAVHLPQPEAEATDDKEARHAQ
 
Nucleotide Sequence: 918 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2024122-2025039 Herminiimonas arsenicoxydans chromosome, complete genome
ATGAAGCACCTTGTACTCGCACTGCTGGGGCTGCTGGCCGTCGCCTCGGCTCCTTTTGCCCAGGCCGTGG
AGATCCTTCGCTGGGAACGCATGCCCCTGGCCGTGCCCCTGCGTGTCGGGCAGGAGCGCGTCGTGTTTAT
CAACCGGAACGTCCGCGTGGGCGTGCCCGCGGGCGTCGGCGAGCGCTTGCGGGTGCAGAGTGCGGGCGGC
GCGGTGTACCTGCGCGCGAGCGAGCCGATCGAGCCCACACGGCTGCAATTGCAGGATGCCGACACGGGCG
CGCTGATTCTGCTCGATATCGCGGCCGAGCCGGCCAAGGACGGCGAAGCCGAGTTGGAGCCGGTGCGCAT
CGTCGAGGGCGACAGCGCCCCGACGCGCTATGGCGATCAAGCCGACGGAGCAGACGACGCCCCGGCGCGC
GCCCAGGACCAGGCAGGCGCGCGGGCAGCGCGGCGTGAAACCCCGGTTCCGGTCGTGCTGACGCGCTTCG
CCGCGCAGAACCTCTACGCACCGCTGCGCACCGTGGAGCCGCTGCCGGGCGTCATGCGGGTGAACCTGCG
CCGCGATCTCGACCTCGGCACGCTGGTGCCGACGCTGCCGGTGCGCGCAGTTGCGCTCGCCTCGTGGCGT
CTGGAAGACCAGTGGGTCACAGCCGTGCGCCTCACCAATAGCAGCGGCGGCTGGATCACCCTGGACCCGC
GCGTGTTGCAGGGCGATTTCCTCACCGCCACCTTCCAGCACGAAGCACTCGGCCCGCGCGGGACGCCAGA
GGACACGACCGTCCTGTACTTGGTGACGCGGGGGCACGGCCTCGCGCAATCGCTGCTGCCGGCGATCAAC
CGCTTCGACCCAGCCGTGCATCTGCCGCAGCCCGAAGCCGAGGCCACCGACGACAAGGAGGCCCGCCATG
CGCAGTAA
 Primer design