SecReT4
Protein ID: 134095210
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2018
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2025029..2026459 [+]
Productsignal peptide
Component typeTfc14
UniProt IDA4G6M5
KEGG IDhar:HEAR2018
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|134095210|ref|YP_001100285.1| signal peptide [Herminiimonas arsenicoxydans]
MRSNGLLKWLMIPVALLVLFVAIRLFSGGGSSAPPAADAGAKLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALETERSNLRRDQQQAASERQQTEGLLADLQRRL
EGIGGRGGGHADLPVGLGLRNGDEAGMEGGVRWVEPDDAKPADGRNGSRGTGGGMSFPTSFGPAQSTLET
TAQTVANAGARAAGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDRDGNQQNNQQQNSQSGGLGWISDPYG
IPCVSGERRSNAQQYLGSQALITAAGAGVASLIDSDSGQMSYVGADGSIGSVGISSNEAVGRILAGGVRD
MADWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2025029-2026459 Herminiimonas arsenicoxydans chromosome, complete genome
ATGCGCAGTAACGGACTCCTGAAGTGGTTAATGATCCCCGTGGCCCTGCTGGTGCTGTTCGTCGCCATCC
GGCTGTTTTCGGGTGGAGGCTCGTCGGCGCCGCCCGCTGCGGATGCCGGCGCCAAGCTCACGCCGGAGGA
GATGAAGGCGCTGGGCATCGAGGGCGATACCCCCCGCGATACCGTGGCGACGCTCGTGGCGCAAGTGAAG
CAGTTGCGCACCGAACTGCAGACGGCGCTGTCCGACAACAAGTCCCAGCGCGAAGAGAACCAGCGCCTGC
GCCAACGCGAGAACTCGATCGACCAGCGCATCAATTCGGCGCTGGAGACCGAGCGCTCCAACCTGCGCCG
CGACCAGCAGCAGGCAGCCAGCGAACGCCAGCAGACCGAGGGACTGCTCGCCGACCTGCAGCGGCGCCTG
GAAGGCATCGGCGGGCGCGGCGGCGGCCACGCCGATCTACCCGTGGGCCTGGGGCTGCGTAACGGCGACG
AGGCAGGCATGGAAGGCGGCGTGCGCTGGGTCGAGCCGGACGACGCGAAGCCCGCTGATGGGCGTAACGG
CAGTCGCGGCACGGGTGGCGGCATGAGCTTTCCGACGAGCTTCGGCCCCGCGCAGAGCACGCTGGAAACC
ACGGCACAAACCGTGGCGAACGCGGGCGCCCGCGCCGCAGGCGTCAAGAGCGCCAAGCCGGTCTATACGG
TGCCGACCAACTCGACGCTGATGGGATCGGTGGCAATGACGGCGCTGATCGGCCGCGTGCCGATCGACGG
TACGGTCAACGATCCGTATCCGTTCAAAGTCCTGGTCGGTCCCGACAATCTCACGGCAAACGGTATCGAC
ATTCCCGACGTGGCGGGCGCCGTGTTTTCCGGCACGGCCTCGGGCGACTGGACGCTCTCTTGCGTGCGCG
GCCAGGTGCGCAGCATCACCTTTGTGTTCCATGACGGGACCATTCGGACGATTCCCGAAGACCGCGACGG
CAACCAGCAGAACAACCAGCAGCAGAACTCTCAAAGTGGGGGCCTGGGCTGGATCAGCGATCCCTATGGC
ATTCCCTGCGTCAGCGGAGAGCGGCGCAGCAACGCCCAGCAGTACCTCGGTTCGCAGGCGCTGATCACCG
CGGCGGGTGCTGGCGTGGCCTCGCTCATCGACAGCGACAGCGGTCAGATGTCCTACGTGGGCGCAGACGG
TTCCATCGGCAGCGTCGGCATTTCCAGCAACGAGGCCGTAGGTCGCATCCTGGCCGGTGGCGTGCGCGAC
ATGGCCGATTGGGTGAACAAGTTGTACGGCCAGGCCTTCGCCGCCGTCTATGTCCAACCCGGCGCAAAGG
TCGCCGTCCACCTCGAAAAGCCGCTCGCCATCGATTTCGATCCCGAAGGTCGCAAGGTCGATCACCGTGC
AGGAGAAAGCCATGCTCTCGAACTTGAATAA
 Primer design