SecReT4
Protein ID: 134095211
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2019
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2026440..2026880 [+]
Productsignal peptide
Component typeTfc15
UniProt IDA4G6M6
KEGG IDhar:HEAR2019
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|134095211|ref|YP_001100286.1| signal peptide [Herminiimonas arsenicoxydans]
MLSNLNKGLALALAVAVLGGCATSKEKLLPHGDSTMMDIWQQNAGDGGGGAGQVARRQLLDARQSLRRPL
TEMDVQAAPAEQMRYTRTARNEVYRQFQRLPNPDLVMYVYPHLAGTDPVPVPGYTTVFPLYQRVQYAMPG
ERVEDY
 
Nucleotide Sequence: 441 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2026440-2026880 Herminiimonas arsenicoxydans chromosome, complete genome
ATGCTCTCGAACTTGAATAAGGGCCTGGCGCTGGCCCTTGCCGTCGCGGTGCTCGGCGGCTGCGCCACCA
GCAAGGAAAAGCTGCTGCCCCACGGCGACAGCACGATGATGGACATCTGGCAGCAGAACGCCGGTGACGG
CGGCGGTGGCGCCGGCCAGGTGGCACGCAGGCAATTGCTCGACGCGCGCCAGAGCCTGCGCCGGCCGCTG
ACCGAGATGGATGTACAGGCCGCGCCCGCCGAGCAGATGCGCTACACGCGCACAGCGCGCAACGAGGTCT
ATCGCCAGTTCCAGCGCCTGCCGAATCCCGACCTGGTGATGTACGTGTACCCGCACCTGGCAGGCACGGA
CCCGGTGCCCGTGCCGGGCTATACGACGGTTTTTCCCTTGTACCAGCGCGTGCAGTACGCCATGCCGGGC
GAGCGCGTGGAGGACTACTGA
 Primer design