SecReT4
Protein ID: 134095215
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2023
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2031378..2031824 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDA4G6N0
KEGG IDhar:HEAR2023
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.1e-40, Aligned region: 35..144
Protein Sequence: 148 a.a.     [Download]
>gi|134095215|ref|YP_001100290.1| hypothetical protein HEAR2023 [Herminiimonas arsenicoxydans]
MPASFPRFAPSWRALGLAVALPVSLGVFSPATFAADVLVITDSRHPVKTMGGERLIELDEAHRIEAELSA
ELPAEPEQATAIVKRRLNSGGTDLQRRIASAYQGVTDAWSLGITSIPAVVVDQRYVVYGEPDVARAVARI
EQHWRAQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2031378-2031824 Herminiimonas arsenicoxydans chromosome, complete genome
ATGCCAGCATCTTTTCCCAGGTTCGCGCCAAGCTGGCGAGCCCTTGGCCTGGCCGTTGCACTGCCGGTGT
CCTTGGGTGTCTTTAGTCCGGCCACATTCGCTGCCGATGTGCTGGTCATCACCGACAGCCGCCATCCGGT
CAAGACCATGGGCGGCGAGCGGCTGATCGAGCTGGACGAAGCGCACCGGATCGAAGCGGAGCTTTCTGCG
GAACTGCCCGCCGAACCCGAGCAGGCGACCGCCATCGTCAAGCGCCGACTGAACAGCGGCGGCACCGATC
TCCAACGCCGCATCGCTTCCGCCTACCAGGGCGTCACCGACGCGTGGAGCCTGGGCATCACCAGCATCCC
GGCCGTCGTGGTGGATCAACGCTACGTCGTCTATGGCGAACCGGATGTGGCCCGCGCAGTCGCTCGCATC
GAGCAGCACTGGAGGGCCCAGCCGTGA
 Primer design