SecReT4
Protein ID: 134095216
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2024
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2031821..2032768 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA4G6N1
KEGG IDhar:HEAR2024
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.5e-94, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|134095216|ref|YP_001100291.1| hypothetical protein HEAR2024 [Herminiimonas arsenicoxydans]
MTRPFDLMRRLRAGVASVLLLSATGSYALNTATIVGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSIKV
RHYIPDAIVSSYSNTGENPWIEVRPMSTPNPSAQTGGDGTTNEDHENNLAKFKNADVIGHPGVEVFNQFV
SSSGYFCEGAGTAFMPYLLGTLDTLAWRYNVPEMAYPEALIPGMREVGARTTMNLWGNVYPRGGFLHQTD
DHKASAVVAQRAGDVVTRRGQIHVYQPLLANSRDGYWPAGALMESDASTGKWQELTPVLSSSCSVFPRSG
ALTQARQGDYAWALWRPYACCERRGQVFLGSVDFL
 
Nucleotide Sequence: 948 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2031821-2032768 Herminiimonas arsenicoxydans chromosome, complete genome
GTGACCCGCCCATTCGACCTGATGCGCCGCCTGCGTGCTGGCGTGGCGTCCGTTCTGCTGCTCAGCGCCA
CGGGCAGCTACGCGCTCAACACCGCAACCATCGTCGGCTCGGTGGCATCGCCAGACTGCCTCGAATACCG
CGTCGTCGGGATCTGCTACTGGCTCTACTGCACCTGGACGGGCTGTACGGTACGCACGTCCATCAAGGTC
CGCCACTACATCCCCGATGCGATCGTCTCCAGCTACAGCAACACCGGCGAAAACCCCTGGATCGAAGTCC
GGCCGATGAGCACGCCCAACCCATCCGCCCAAACCGGCGGGGACGGAACGACGAACGAGGACCACGAAAA
CAACCTCGCCAAGTTCAAGAACGCGGACGTCATCGGGCACCCGGGCGTCGAGGTGTTCAACCAGTTCGTG
TCGTCCTCGGGCTACTTCTGCGAGGGTGCGGGCACGGCGTTCATGCCGTACTTGCTCGGCACCCTGGACA
CGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAGGCGCTAATTCCCGGCATGCGTGAGGT
CGGTGCACGCACCACGATGAACCTCTGGGGCAACGTGTATCCCCGCGGGGGTTTCCTGCACCAGACCGAC
GACCACAAGGCCAGTGCAGTGGTGGCCCAGCGCGCAGGCGATGTCGTCACGCGCCGGGGACAGATCCACG
TTTATCAGCCGCTGCTCGCCAACTCCCGCGATGGCTACTGGCCGGCTGGCGCGCTCATGGAGAGCGATGC
CTCGACGGGCAAGTGGCAGGAACTCACGCCAGTCCTGTCCTCGTCCTGCTCGGTCTTCCCGCGCAGCGGC
GCCCTGACACAGGCCCGGCAAGGCGATTACGCCTGGGCGCTGTGGCGGCCCTATGCGTGCTGCGAACGCC
GGGGCCAGGTGTTTCTCGGCAGCGTCGATTTCCTCTGA
 Primer design