SecReT4
Protein ID: 134095217
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2025
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2032931..2034175 [+]
Productsignal peptide
Component typeTfc22
UniProt IDA4G6N2
KEGG IDhar:HEAR2025
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 414 a.a.     [Download]
>gi|134095217|ref|YP_001100292.1| signal peptide [Herminiimonas arsenicoxydans]
MYSIGGGNAVSMGRAAGMRSLGVGVGWNSNLICGDMSIQTTLKNQLNGVTNGFQQIMSSVIQSATSAVAS
LPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAERMAETAGGQLGWSQMAEGLALRDAVSSTDA
VSAVEQAETRRGNDGVPWVGGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPTSCSSLSCQTW
TSPQAAVEWATRVLGEKEQRTCDACTKTETTPGVGLTPLIQEEYDAKLQALQDLVSKAKNTTPENLREAG
SASLPITRGVIEALRDEPDQHLLSQRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNKES
DTLDREIQNLKTELELRRELANNSPMAIIQRHSTRASGSRGIYEGDPVPDRLDQLQKGNPGGRP
 
Nucleotide Sequence: 1245 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2032931-2034175 Herminiimonas arsenicoxydans chromosome, complete genome
ATGTACTCGATCGGCGGCGGAAACGCCGTGTCGATGGGACGTGCGGCTGGCATGCGCTCTCTCGGGGTCG
GCGTGGGCTGGAACAGCAACTTGATCTGCGGTGACATGAGCATCCAGACCACGTTGAAGAATCAGCTCAA
CGGCGTCACCAACGGCTTCCAGCAAATCATGTCATCGGTGATCCAAAGCGCCACCAGCGCGGTGGCGTCG
TTGCCGGCACTGATCATTCAGCGGGCCGATCCCGGCCTCTACAACCTGCTCACCAATGGCGTGTTGCAGG
CACGGCTCGATTTCGACCGCTCCAAGCTGACGTGCCGTGCCATGGCGGAGAGGATGGCCGAGACGGCGGG
CGGGCAGCTCGGCTGGAGCCAGATGGCAGAAGGCTTGGCGCTGCGCGATGCGGTGTCGAGCACGGATGCG
GTCTCGGCCGTCGAGCAGGCCGAGACGCGCCGCGGCAATGACGGTGTGCCGTGGGTCGGGGGCAGCAACG
CGGGAGGCTCCGGCCAGCCCGCGATCAAGGTCGTCGGCGATGTCACCCGCGCCGGCTACAACCTGGTCAA
CGGCCGCGGCGTGACCGATACATCGTCCATCGCACCGACCAGTTGCAGCAGTCTCTCGTGCCAGACCTGG
ACCTCGCCGCAGGCCGCCGTCGAGTGGGCCACGCGCGTACTCGGCGAGAAGGAACAGCGCACTTGCGATG
CCTGCACCAAGACCGAGACGACGCCCGGCGTAGGGCTGACGCCGTTGATCCAAGAAGAATACGACGCCAA
GCTGCAGGCGCTCCAGGATCTGGTGTCCAAGGCGAAGAACACGACGCCCGAGAACCTGCGCGAGGCTGGC
AGTGCATCGCTGCCCATCACCCGCGGCGTGATCGAGGCGCTGCGTGACGAGCCGGACCAGCACCTGCTGT
CGCAGCGCCTGGCGTCCGAGGTCGCGCTGTCCTCCGTGCTGGAGAAGGCGCTGTTGCTACAGCGCACGCT
GCTCACGGGCAAGAAAGAGCCCAACGTCGCGGCCAACGAGCTTGCGGTGGAGGCCGTGAACAAGGAGAGC
GATACGCTCGACCGCGAGATCCAGAACCTCAAAACGGAACTGGAACTGCGCCGCGAGCTGGCCAACAACT
CGCCGATGGCCATCATTCAGCGCCATAGCACGCGCGCTTCGGGTTCGCGCGGCATCTACGAGGGCGATCC
GGTGCCCGACCGTCTCGACCAACTCCAGAAGGGCAATCCGGGAGGTCGGCCATGA
 Primer design