SecReT4
Protein ID: 134095219
T4SS name [ID]Tfc [710]
Gene symbol-
Locus tagHEAR2027
StrainHerminiimonas arsenicoxydans
Repliconchromosome [GenBank: NC_009138] [Browse all T4SS(s) in this replicon]
Location [Strand]2034547..2036064 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA4G6N4
KEGG IDhar:HEAR2027
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.7e-127, Aligned region: 10..483
Protein Sequence: 505 a.a.     [Download]
>gi|134095219|ref|YP_001100294.1| hypothetical protein HEAR2027 [Herminiimonas arsenicoxydans]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVIQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLSTIQYDSSRSAQCQVSVPQPAQTGWSQSFSTISNQSAKVPVWWAFMHALS
RAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFTHDCYGPARAKLFMARPELDETQMNDVTW
IGSRFFTDTGGYYDSYRSSTAREAWPYDDTRDAGLAQVANGGGYPTCRQWWSDGSNGLRARLLGQVDPSL
LNRLAGWAGFLSRAEVDDSVIRAIASPRQQKLNQGSVYTDYGGQIDKTLPNVVNRATSDVGLAVGALAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVVGTYDLKMVVTVSTVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVTGTMFLVLPTFWVAALGWVGVKAGVIAQNLAVGSKEAR
DSAGSGVNKVTGKVL
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|134093294|ref|NC_009138.1|:2034547-2036064 Herminiimonas arsenicoxydans chromosome, complete genome
ATGACGCTTTTCACGACCGACTACCTGGAGTACTACCTCACCCTCGTGTCCTGGATCGTCAACAACGGCA
TCTGGGCCGTGCTGGTGTCCAGCGGGGTGTTTGCGCTGCCCTTTGTGGCGATCGTCATCCAGGAATGGCT
CAAGGCCAGAGCGGAGGGCGCCGACGAAGGCAACAAGGGCGTGCTCTCGGCGGCGCGCATCGAGAACCGA
GTATTTGTGGCCATCGTGGTCGTGATGTTCGCCGGCATTCCGTTCATCGACGTCGACCTCAGCACTATCC
AGTACGACAGCTCGCGCTCGGCGCAGTGCCAGGTCAGCGTGCCGCAGCCCGCGCAAACTGGCTGGTCGCA
GTCCTTCAGCACCATCAGCAACCAGTCGGCGAAGGTTCCGGTCTGGTGGGCTTTCATGCACGCGCTTTCG
CGCGCCGTCACGAGCGCCTCGGTGGCTGCGATCCCGTGCGGCACGGATCTGCGGCAGATGCGGATGGAGA
TCGATGCCACACGCATCGACGACCCGGTGCTGGCCCAAGAAGTGGCGGATTTCACGCACGATTGCTATGG
ACCGGCTCGCGCCAAATTGTTCATGGCGCGGCCGGAGCTGGACGAAACGCAGATGAACGATGTGACCTGG
ATCGGTTCGAGGTTTTTCACGGACACGGGCGGTTACTACGACAGCTACCGCTCTAGCACGGCGCGCGAGG
CATGGCCCTATGACGACACCCGCGACGCTGGGCTTGCGCAGGTTGCCAATGGTGGCGGCTACCCGACCTG
CAGGCAGTGGTGGTCCGACGGCAGTAACGGACTGCGCGCGCGGCTGCTGGGGCAAGTGGACCCAAGCCTG
CTGAATCGCCTGGCGGGCTGGGCTGGATTCCTGAGCCGGGCCGAGGTGGACGACTCCGTGATCCGCGCCA
TCGCGTCACCGCGGCAGCAGAAATTGAACCAAGGCAGCGTCTATACGGACTACGGCGGTCAGATCGACAA
GACATTGCCCAATGTCGTCAACCGTGCCACCAGCGATGTTGGCTTGGCGGTTGGGGCTCTCGCCGCCTTC
CCGGCAATGGACGTAGTGCGCCAAGCACTGCCCATGGTGCTCGCGCTGCTCAAGATGGCGCTCGTGATCT
GCATTCCGCTAGTGCTGGTCGTGGGCACCTATGACCTGAAGATGGTCGTCACCGTCAGCACCGTCCAGTT
CGCGCTGTTCTTCACGGACTTCTGGTTTCAGCTCGCACGCTGGATCGACAGCACCATCCTCGATGCGCTC
TACGGGTGGGGCTTTGGCTGGAACCGGCCGCATACCAACTTCGACCCGCTGGTGGGGCTGAACAATGCCT
TCGGCGACATGCTTTTGATGTTCGTCACCGGCACGATGTTCTTGGTCCTGCCGACTTTCTGGGTGGCAGC
GCTTGGGTGGGTCGGAGTAAAAGCCGGGGTAATCGCTCAGAACCTGGCTGTCGGTTCCAAGGAAGCACGC
GACAGCGCGGGATCAGGCGTAAACAAGGTTACCGGCAAGGTGCTTTGA
 Primer design