SecReT4
Protein ID: 134287555
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7057
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]26976..27851 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbI
UniProt IDA4JUI7
KEGG IDbvi:Bcep1808_7057
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-48, Aligned region: 66..283
Protein Sequence: 291 a.a.     [Download]
>gi|134287555|ref|YP_001109721.1| conjugal transfer protein TrbG/VirB9/CagX [Burkholderia vietnamiensis G4]
MKRTRTLLSWGALAFIAASANAFAAKNAASPIAPIPSFDVGSIIGDAMSPVNPYNSGTDPITMPGDARMA
VFSYSRDKIFRVMTAPLKLTTIELERGETLISEPAMGDSVQWVLDTDGANHVYVKPTKPGLVNTLHLSTN
KREYELTLVSSPLGGLFYQNVRFNYPNSLMAKVRARSDATEDDLEAKHDSQSDSGPIGVSPDKLNFDYTV
SGTSSLKPETVFDDGTFIWIRMPSRTPFAVPTIKDGGDIVSPNFIRRGPYIVIQRLADEVKLTRPGEEVT
ITRGRRGLFGF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|134287530|ref|NC_009227.1|:26976-27851 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGAAACGAACACGTACCCTCCTGAGCTGGGGCGCGCTCGCGTTTATCGCAGCGTCGGCCAACGCGTTCG
CCGCAAAGAATGCCGCGAGTCCGATTGCCCCGATCCCGAGTTTCGACGTCGGCAGCATCATCGGCGATGC
GATGAGTCCGGTTAACCCGTACAACTCCGGCACCGACCCGATCACCATGCCAGGTGATGCGCGCATGGCC
GTGTTTTCGTACAGCCGCGACAAGATCTTTCGGGTTATGACGGCGCCGCTAAAGCTCACGACCATCGAGC
TCGAACGTGGCGAAACGCTCATCAGCGAGCCGGCTATGGGTGACTCGGTGCAGTGGGTGCTCGACACCGA
TGGCGCGAATCATGTCTACGTGAAACCGACCAAGCCCGGCCTCGTCAACACGTTGCACTTGAGCACGAAT
AAGCGCGAGTACGAACTCACGCTTGTCTCGTCGCCGTTGGGCGGGCTGTTCTACCAGAACGTGCGCTTCA
ATTACCCCAACTCTCTGATGGCGAAGGTACGCGCACGCAGCGACGCCACTGAAGACGACCTCGAAGCTAA
GCATGACTCACAGTCTGACTCCGGCCCAATCGGCGTGTCGCCAGACAAGCTGAACTTCGACTACACCGTC
TCGGGCACGAGCTCCCTTAAACCCGAGACAGTCTTCGACGATGGCACGTTCATCTGGATTCGGATGCCGT
CACGCACGCCATTTGCCGTGCCGACTATCAAGGACGGTGGCGACATCGTCAGCCCGAACTTTATCCGCCG
CGGGCCGTACATCGTCATCCAGCGCCTGGCTGACGAGGTGAAGCTTACGCGGCCGGGTGAGGAGGTGACG
ATCACACGCGGCCGTCGCGGCTTGTTCGGATTCTGA
 Primer design