SecReT4
Protein ID: 134287556
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7058
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]27858..29132 [+]
Productconjugation TrbI family protein
Component typeTrbG
UniProt IDA4JUI8
KEGG IDbvi:Bcep1808_7058
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.4e-42, Aligned region: 236..417
Protein Sequence: 424 a.a.     [Download]
>gi|134287556|ref|YP_001109722.1| conjugation TrbI family protein [Burkholderia vietnamiensis G4]
MAKQTDPTSPEEKALFKGKVPRNVMIAVGAIAALAIGGLGFYTQTIEANKAEAEALQAKRERAAEAVERS
SANKTDVDKIIEEQQAEARRRAAEAAAASSAAAAANAKKPTLSADAVLPTGNTEELKASNDQDSIFVSPI
FRAGVKVKDAQPQQPQLPNGVISPQQMLLQQAAAQDAAVKEATAQAALASRGGQGVGAMTTQKRDTAFLN
DVAQLSEGNKDFARTGIVGQSHGCTLSPPAKIPVLSSEALNSDRPGTASLIVESDVYANNGDGRCLVIPW
GTTIVAPYSSDIQPGQESILVAGAEMRLPNGKHVPLYGAQGANGDGAAGFSGHVNNHFLRIYSTSFLTAI
LVRAFSNSDQSTTTGPLGVTQAGSTAGQIAAQTAQSVLDRYKNIPPTITSSPGERHFMLKVNRDMVLEQY
RGPR
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|134287530|ref|NC_009227.1|:27858-29132 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGGCAAAACAGACCGATCCGACCAGCCCGGAAGAGAAAGCTTTGTTCAAAGGGAAGGTGCCGCGCAACG
TTATGATTGCCGTTGGCGCGATCGCGGCCCTCGCTATAGGCGGGCTGGGTTTCTACACGCAGACTATCGA
AGCCAACAAGGCCGAGGCAGAAGCACTGCAGGCCAAACGTGAACGTGCTGCCGAAGCAGTCGAAAGGAGC
AGCGCGAACAAGACTGACGTCGACAAGATCATCGAGGAACAGCAAGCGGAAGCGCGCCGACGAGCTGCTG
AAGCGGCTGCAGCATCCAGTGCTGCGGCCGCCGCGAACGCGAAGAAGCCGACGCTTTCGGCTGACGCCGT
CTTGCCGACCGGCAACACGGAGGAGCTCAAAGCTTCGAATGACCAGGACAGCATCTTCGTCTCCCCGATT
TTCCGGGCGGGCGTTAAGGTCAAGGATGCGCAGCCGCAGCAACCGCAACTGCCAAACGGCGTTATCTCGC
CGCAACAGATGCTGCTTCAGCAGGCGGCGGCTCAAGACGCTGCGGTGAAGGAAGCGACCGCGCAAGCAGC
CCTGGCTTCACGCGGCGGACAGGGAGTCGGTGCGATGACGACCCAGAAGCGCGATACCGCTTTCCTAAAT
GACGTTGCGCAGTTGAGCGAGGGTAACAAGGATTTTGCGCGAACTGGCATTGTTGGCCAGTCGCACGGAT
GCACGTTGTCGCCGCCGGCGAAGATTCCGGTTCTCTCGAGCGAGGCACTCAACTCCGACCGTCCCGGAAC
CGCGTCGCTGATCGTCGAGAGCGACGTGTACGCGAACAATGGCGACGGCCGGTGCCTTGTGATTCCGTGG
GGCACCACCATCGTTGCGCCGTACAGCTCGGACATCCAACCTGGGCAGGAGTCGATTCTCGTTGCCGGGG
CGGAAATGCGTCTGCCGAACGGCAAGCACGTACCGTTGTACGGCGCACAGGGCGCTAACGGCGATGGCGC
TGCCGGGTTCAGTGGACATGTCAACAACCACTTCTTGAGGATCTATTCGACGTCGTTCCTGACTGCGATT
CTGGTCCGTGCCTTCAGCAATAGTGATCAGAGCACTACGACCGGCCCGCTCGGCGTCACTCAAGCAGGGA
GCACGGCCGGTCAAATCGCTGCGCAGACAGCGCAGTCGGTACTCGATCGCTACAAGAACATCCCGCCCAC
GATCACCTCGTCACCCGGTGAGCGGCATTTCATGCTCAAGGTCAATCGCGACATGGTGCTCGAACAGTAT
CGGGGGCCGCGATGA
 Primer design