SecReT4
Protein ID: 134287557
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7059
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]29129..29935 [+]
Productlytic transglycosylase, catalytic
Component typeTrbN
UniProt IDA4JUI9
KEGG IDbvi:Bcep1808_7059
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 268 a.a.     [Download]
>gi|134287557|ref|YP_001109723.1| lytic transglycosylase, catalytic [Burkholderia vietnamiensis G4]
MIARAAFAVAFALACAQAQSAVIAQVISPVSVVIQDGATRRVAMLPGKPVYYCGLDAFVDWASPLIGQPV
RSSRDAGITVSIDGRDVALDDLFIDRGWLQPPVLDEGAQVALAERRGGWACSRAVVPFELLHTNVDPKIL
AGIALNESNYRGRAWPWTLNVAGQGYFFKSREEAYKAIESLLARDRCDFDVGLMQVNWCYHGKRFASAWA
ALAPATNVAAAEAILTENFARTDSVAKAVAYYHSANPTPGRAYLARFAQHLSMIEAGL
 
Nucleotide Sequence: 807 bp     [Download]
>gi|134287530|ref|NC_009227.1|:29129-29935 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGATCGCGCGCGCGGCCTTTGCCGTCGCATTCGCGCTTGCGTGCGCACAGGCGCAGTCGGCCGTGATCG
CGCAGGTTATCAGCCCGGTGAGCGTCGTCATTCAAGACGGGGCGACGCGCCGTGTCGCAATGCTACCCGG
CAAGCCGGTCTACTACTGCGGTCTTGACGCCTTCGTCGACTGGGCATCACCGTTGATCGGCCAGCCGGTG
CGCAGCTCGCGGGACGCCGGCATCACGGTATCGATCGATGGCCGCGACGTTGCGCTGGACGATCTGTTTA
TCGACCGTGGATGGCTACAGCCGCCGGTGCTGGATGAGGGTGCGCAGGTGGCGCTCGCCGAGCGCAGGGG
CGGGTGGGCGTGCTCGCGCGCGGTTGTTCCGTTCGAGCTACTACACACCAACGTAGACCCGAAGATACTC
GCTGGCATCGCGCTTAACGAATCGAATTACCGCGGTCGCGCATGGCCGTGGACGCTTAATGTCGCGGGTC
AGGGTTACTTCTTCAAGTCCCGTGAGGAGGCGTACAAGGCAATCGAGTCGTTGCTCGCGCGCGACCGCTG
CGATTTCGACGTCGGCCTGATGCAAGTGAATTGGTGCTACCACGGCAAACGCTTTGCGTCTGCATGGGCC
GCGCTCGCGCCCGCGACAAACGTTGCAGCCGCTGAGGCGATTCTCACGGAGAACTTCGCACGTACCGACT
CCGTGGCGAAGGCGGTCGCGTATTACCACAGCGCGAATCCCACTCCCGGGCGCGCTTACCTCGCACGCTT
CGCCCAACACCTTTCTATGATCGAGGCAGGCCTGTGA
 Primer design