SecReT4
Protein ID: 134287609
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7111
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]75925..76971 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA4JUP1
KEGG IDbvi:Bcep1808_7111
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.9e-61, Aligned region: 28..322
Protein Sequence: 348 a.a.     [Download]
>gi|134287609|ref|YP_001109775.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
MSEIAENPLLKVARLEENAVQLFFESLKLIKPYLESSTVAEVMINSANNIWVEERGEMRRLDIEFNPSTL
TGAIHSLAASVEKSALAGTAQGIINGGHKNLRIATVMKPTAIDGDALAIRRHRETNLSINDYAKMGAFSL
VHAKRSVDRPIFPPGVADEALAEAFTAMVQQRANVLVAGGTSAGKTTFLNSLNGLIPREERVITIEDTME
LKVDLPNRVRLLSNPDKGVTTQILVALCLRFRPDRIIVGEVRGGEAYDFIQALSTGHDGGMGSIHSNDAR
GGLTRLESLAMLGIPPGSRWELADMRKAIAECFHYVIHLRRTGELRHVSEVLAIKGFKDGDYVLERVF
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|134287530|ref|NC_009227.1|:75925-76971 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGTCTGAAATTGCCGAAAATCCCTTGCTGAAGGTCGCACGGCTCGAAGAGAACGCTGTACAGCTGTTCT
TCGAGTCGCTGAAGCTCATCAAGCCCTACCTCGAATCCTCGACCGTAGCCGAAGTCATGATCAATTCGGC
GAACAACATCTGGGTCGAGGAGCGGGGCGAGATGCGCCGGCTCGATATCGAGTTCAATCCGTCGACACTG
ACAGGGGCCATTCACTCGCTCGCGGCCTCTGTTGAAAAGTCGGCGCTCGCGGGCACGGCCCAAGGGATTA
TCAACGGCGGCCACAAGAACCTCCGGATTGCGACGGTCATGAAGCCGACCGCGATTGACGGCGACGCGCT
CGCGATCCGTCGGCACCGCGAGACCAATCTGTCGATCAACGATTACGCGAAGATGGGCGCGTTCTCTTTG
GTCCATGCAAAGCGAAGCGTCGATCGACCGATCTTCCCACCCGGCGTCGCTGACGAAGCGCTCGCCGAGG
CGTTCACCGCGATGGTTCAACAGCGCGCCAACGTGCTCGTTGCTGGCGGTACCTCCGCGGGCAAGACGAC
GTTCCTGAACTCGCTGAACGGCTTGATACCACGCGAGGAGCGAGTCATCACGATCGAGGACACGATGGAG
CTAAAGGTCGACCTTCCAAACCGTGTCCGGTTGCTGTCGAACCCTGACAAAGGTGTGACGACGCAGATCT
TGGTGGCGCTGTGCCTGCGATTCCGGCCCGACCGAATCATCGTGGGTGAAGTTCGTGGCGGCGAAGCATA
TGACTTCATCCAGGCGCTGAGCACCGGCCACGACGGCGGAATGGGTTCGATTCACTCCAATGATGCGCGC
GGCGGACTGACCCGCCTTGAGAGCCTCGCGATGTTGGGCATCCCGCCAGGCAGCCGCTGGGAACTCGCCG
ACATGCGCAAAGCAATCGCCGAGTGCTTCCACTACGTCATCCACCTGCGACGCACGGGCGAACTGCGTCA
CGTGTCCGAGGTGCTGGCAATCAAAGGGTTCAAAGACGGGGACTACGTCCTTGAACGCGTTTTCTAA
 Primer design