SecReT4
Protein ID: 134287610
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7112
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]76989..77369 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDA4JUP2
KEGG IDbvi:Bcep1808_7112
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.1e-06, Aligned region: 30..110
Protein Sequence: 126 a.a.     [Download]
>gi|134287610|ref|YP_001109776.1| hypothetical protein Bcep1808_7112 [Burkholderia vietnamiensis G4]
MKKHIKSLSSRARKKLLATSHYLFGRGQRLSTLTALLLTFSAPAAKAVDLGDMGNAADFICLIQAYVSGP
WLYGIGIVLIIVGAVMISNSESNFGKFLSTIVVGLGVASCAIPIVKNHLKINYTCA
 
Nucleotide Sequence: 381 bp     [Download]
>gi|134287530|ref|NC_009227.1|:76989-77369 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGAAGAAGCACATTAAGTCGTTGAGTTCGCGAGCTCGGAAAAAGTTGCTGGCTACCAGTCACTACCTGT
TCGGACGGGGCCAGCGGCTCTCGACTCTGACCGCGCTACTCCTGACATTTTCCGCTCCGGCCGCGAAAGC
GGTCGATCTCGGGGATATGGGCAATGCGGCCGACTTCATCTGTTTGATCCAGGCATACGTCAGTGGGCCG
TGGCTCTATGGAATCGGCATCGTGCTGATCATCGTTGGCGCAGTCATGATCTCGAACTCGGAGAGCAACT
TCGGGAAATTCCTCTCGACCATCGTTGTCGGTTTGGGCGTCGCGTCGTGTGCAATCCCGATCGTCAAAAA
TCATTTGAAGATCAACTACACCTGTGCGTGA
 Primer design