SecReT4
Protein ID: 134287611
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7113
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]77410..77673 [+]
Producthypothetical protein
Component typeTrbD
UniProt IDA4JUP3
KEGG IDbvi:Bcep1808_7113
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.7e-06, Aligned region: 2..55
Protein Sequence: 87 a.a.     [Download]
>gi|134287611|ref|YP_001109777.1| hypothetical protein Bcep1808_7113 [Burkholderia vietnamiensis G4]
MGGADRGLAIANGTLTTLLCYSSMSLVYLVIGIVVHWVLRWLSSSDPWWKEVLVVYNRYPDVHEPLHTAD
FAARFRRPYGFDQELPL
 
Nucleotide Sequence: 264 bp     [Download]
>gi|134287530|ref|NC_009227.1|:77410-77673 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGGGCGGCGCAGATCGCGGCCTCGCGATTGCCAACGGGACGCTGACGACGCTGCTGTGCTACAGCAGCA
TGTCGCTGGTCTATCTTGTCATCGGCATCGTGGTGCACTGGGTGCTGCGCTGGCTGTCTTCGAGCGATCC
GTGGTGGAAGGAAGTACTGGTCGTCTACAACCGGTATCCGGATGTGCACGAGCCACTGCACACCGCCGAT
TTCGCTGCCCGGTTTCGGCGGCCGTATGGATTTGATCAGGAACTCCCACTGTGA
 Primer design