SecReT4
Protein ID: 134287612
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7114
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]77670..80147 [+]
Producttype IV secretory pathway VirB4 components-like protein
Component typeTrbE
UniProt IDA4JUP4
KEGG IDbvi:Bcep1808_7114
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.5e-17, Aligned region: 194..298
CagE_TrbE_VirB [PF03135], Evalue: 3.5e-17, Aligned region: 313..410
AAA_10 [PF12846], Evalue: 2.3e-15, Aligned region: 473..754
Protein Sequence: 825 a.a.     [Download]
>gi|134287612|ref|YP_001109778.1| type IV secretory pathway VirB4 components-like protein [Burkholderia vietnamiensis G4]
MSANPKRRAIQEIAPWATMVTPEVILDKDGSLLTLYTFEGVDADSPNSDEISAARDNLDHACKNFDHRIT
AWWRMSHRRVRGEIGGQFASEMDERVDAINQRSVGSGKFFRNTHSLALAYTPETGINKLFEKIAYHITVG
GKSVPIALLETIKDMVFSRSAFVFDMERITSDIKRFEGILDAFKGGVARLKMKRLQLQHALAFLHQAANP
SVPPRRVRYPVTMLDTHLTETFVTYGAEHIMFESAYGTRYAKIISVKEWMGFQEAALDVLADVDAEFDVC
VMFRFLSTSKAQAYIEKMRKFYKVAAFSPVKILKGFFSKDEKKESMENERGREILAEEAENALARLIADG
QQYGFVNISVVVYGDTSDECDDHAREIVGRIGNAGFGVLIEKRNLPAAWASTLPGRWDQQKRLQFVETPV
VSDIAPVRGVAEGSDVNQWLTQQLGRKVGPLTLLPTRHRTLQRITLHDPSGKSHTLIVGPIGAGKTIFLN
FLVSQTGRFAPRRIKFDKNRSTRIPTMFADGKFVDATGKFAAATQVNPLSMLVDPRHYTYVSGWVQMAIE
GDGEDFRCTPQQERTIYERVVTLAQGYGPEFWTLSFLTTLLPVELRDRLQIWTKGEKNGRFFDHVEDAFS
LSDDLAIEMGELFESYPVAAALFMDYAFYRISQWLDGKRVTIIEVEECGFFFRYPRFYARLEMWAVTIRG
LNGTLVMATQSLSQLERVPNFEILKENIQNFFFLPNRDARNNKRLYRDVFGLTDDQIDMISDGIPNRDYL
WVTPDHSRMLQAKFPKEALAILRADGAAQRTLDKHLASGSPTWREDYLKEIATVD
 
Nucleotide Sequence: 2478 bp     [Download]
>gi|134287530|ref|NC_009227.1|:77670-80147 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
GTGAGTGCGAACCCGAAACGTCGAGCGATTCAGGAAATCGCGCCGTGGGCCACGATGGTGACCCCCGAAG
TCATTCTGGACAAGGATGGGTCGCTGCTAACGCTGTACACATTCGAAGGCGTGGACGCGGATAGCCCCAA
TTCCGACGAAATCTCGGCGGCGCGCGACAACCTCGATCACGCCTGCAAGAATTTCGATCACCGGATTACG
GCATGGTGGCGCATGTCGCATCGACGTGTCAGGGGCGAGATCGGCGGCCAGTTCGCGTCGGAGATGGATG
AGCGCGTCGACGCGATCAACCAACGGAGCGTAGGAAGCGGAAAGTTCTTCCGCAACACGCACTCGCTCGC
GCTCGCGTATACGCCCGAGACAGGGATCAACAAGCTGTTCGAGAAGATCGCCTATCACATCACGGTGGGG
GGCAAGTCGGTCCCGATCGCGTTGCTCGAGACGATCAAGGATATGGTGTTCTCGCGGAGCGCATTTGTGT
TCGACATGGAGCGCATCACGTCGGATATCAAGCGCTTCGAAGGGATCCTAGACGCGTTCAAGGGTGGCGT
CGCCCGCCTCAAAATGAAGCGGCTCCAGCTTCAGCACGCACTTGCATTCCTTCATCAGGCTGCGAATCCG
TCGGTTCCCCCTCGTCGCGTGCGCTACCCCGTGACGATGCTCGATACGCACCTGACGGAAACCTTCGTGA
CATACGGCGCTGAGCACATCATGTTCGAATCCGCCTATGGGACACGTTACGCGAAGATTATCTCGGTGAA
AGAGTGGATGGGGTTCCAGGAGGCTGCACTCGACGTCCTCGCCGACGTCGACGCCGAGTTTGACGTATGC
GTCATGTTTCGATTCCTCTCGACAAGCAAGGCGCAGGCGTACATCGAGAAGATGCGCAAGTTCTACAAGG
TTGCCGCGTTCAGTCCGGTCAAGATCCTGAAGGGCTTCTTCTCGAAGGACGAGAAGAAGGAGAGCATGGA
GAACGAGAGAGGGCGCGAGATCCTGGCCGAAGAGGCAGAGAACGCGCTTGCTCGGCTGATTGCGGACGGG
CAGCAGTACGGCTTCGTGAACATCTCGGTAGTGGTGTATGGGGACACAAGCGACGAGTGCGACGACCACG
CACGCGAGATCGTCGGCCGCATTGGCAATGCTGGTTTCGGAGTGTTGATTGAAAAGCGCAATCTGCCGGC
GGCGTGGGCCTCGACTCTGCCTGGGCGATGGGATCAGCAGAAGCGATTGCAGTTCGTTGAGACCCCCGTT
GTCTCAGACATCGCGCCGGTGCGCGGCGTTGCGGAGGGCAGCGACGTCAACCAATGGCTCACCCAGCAGC
TCGGGCGAAAGGTCGGCCCACTCACGCTGCTCCCGACCCGTCACCGGACGTTGCAGCGCATCACGTTGCA
CGACCCGAGTGGGAAATCGCACACGCTGATCGTCGGGCCGATCGGCGCCGGCAAAACGATCTTTCTCAAT
TTTCTCGTTTCGCAAACGGGCCGCTTCGCGCCGCGGCGGATCAAGTTCGACAAGAATCGTTCGACGCGCA
TTCCGACCATGTTCGCTGACGGTAAGTTCGTCGATGCAACGGGCAAGTTCGCGGCCGCGACGCAGGTCAA
TCCACTCTCGATGTTGGTGGACCCGCGGCACTACACCTACGTGTCGGGCTGGGTTCAGATGGCAATCGAA
GGCGACGGCGAGGATTTCCGCTGCACCCCGCAACAAGAGCGGACGATCTACGAACGCGTTGTCACGCTTG
CACAGGGCTATGGCCCGGAGTTCTGGACGCTGTCGTTTTTGACGACTCTATTGCCCGTAGAGCTGCGCGA
TCGCCTTCAGATCTGGACGAAAGGCGAGAAGAACGGTCGGTTCTTCGATCACGTCGAAGACGCGTTCTCC
CTATCCGACGACCTGGCGATCGAGATGGGCGAGCTATTCGAAAGCTATCCGGTGGCCGCCGCGCTGTTCA
TGGACTACGCGTTCTACCGCATCTCGCAATGGCTGGACGGAAAGCGCGTCACGATCATTGAGGTCGAGGA
GTGCGGCTTCTTCTTCCGGTATCCGCGCTTCTACGCGCGCCTGGAGATGTGGGCCGTCACGATTCGCGGG
CTGAATGGGACGCTCGTTATGGCGACTCAATCGCTGAGCCAGCTCGAGCGCGTGCCGAACTTCGAGATCT
TGAAGGAGAACATCCAGAACTTCTTCTTCCTGCCGAACCGCGACGCGCGCAACAACAAGCGTCTCTATCG
AGATGTATTTGGCCTGACCGACGACCAGATCGACATGATCAGCGATGGCATCCCGAACCGAGACTACTTA
TGGGTCACGCCCGACCATTCGCGAATGCTTCAGGCGAAGTTTCCCAAGGAGGCACTCGCGATCTTGCGTG
CAGACGGTGCTGCGCAGCGCACGCTTGACAAGCATCTTGCGAGCGGCTCGCCGACCTGGCGTGAGGACTA
TCTGAAAGAAATTGCAACCGTCGACTGA
 Primer design