SecReT4
Protein ID: 134287613
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7115
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]80380..81123 [+]
Producthypothetical protein
Component typeTrbJ
UniProt IDA4JUP5
KEGG IDbvi:Bcep1808_7115
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 9.5e-10, Aligned region: 11..45
Protein Sequence: 247 a.a.     [Download]
>gi|134287613|ref|YP_001109779.1| hypothetical protein Bcep1808_7115 [Burkholderia vietnamiensis G4]
MKNMRTFRAAVVAASMFMTQHAFAQLVVFDPTNFAQNVITAAKAVKGEIYQNTNILYQYQMMMNDLLQAQ
NLNPAAWKAAYDQITGDIKKVNALVGTLQGLYGDLNKGGEWVTQVQGLISRSGKSNAQWFSDMNTLFQQN
DKVARNLFQMGSNIMQHTSDLAVRRQQLQSQLSMSPTQQATAEITTHYLDIVTSQNADILQLSAAKAQKD
AQKDAQQAEDDKEKAADAEKFISKQQAERAAYGINSQ
 
Nucleotide Sequence: 744 bp     [Download]
>gi|134287530|ref|NC_009227.1|:80380-81123 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGAAAAACATGCGGACTTTTCGCGCTGCTGTCGTCGCGGCGTCGATGTTTATGACGCAACATGCGTTCG
CACAGTTAGTGGTGTTCGACCCGACGAACTTCGCACAGAACGTAATTACGGCAGCCAAGGCCGTCAAGGG
CGAGATATATCAGAACACAAACATCCTCTACCAGTATCAGATGATGATGAACGATCTGCTCCAGGCTCAG
AATCTGAACCCGGCCGCCTGGAAAGCGGCGTATGACCAGATCACTGGGGACATCAAAAAGGTCAATGCGC
TGGTGGGAACTCTGCAAGGGCTCTACGGGGACCTGAACAAGGGGGGCGAGTGGGTGACCCAGGTGCAGGG
TTTGATCAGCCGGTCTGGAAAGTCGAACGCGCAGTGGTTCTCCGACATGAACACGTTGTTCCAACAGAAC
GACAAAGTCGCGCGGAACCTGTTCCAGATGGGCTCGAACATCATGCAGCACACAAGCGACCTCGCGGTTC
GCCGGCAGCAACTGCAATCGCAGCTTTCGATGTCGCCGACTCAGCAGGCGACCGCTGAGATCACGACGCA
TTACCTCGACATCGTGACGAGCCAGAATGCGGACATCCTTCAGTTGAGCGCGGCGAAAGCCCAGAAGGAT
GCTCAGAAGGACGCGCAGCAGGCGGAGGATGACAAGGAGAAGGCTGCGGACGCTGAGAAGTTCATTTCCA
AGCAACAGGCTGAGCGCGCCGCCTACGGGATCAATTCACAATGA
 Primer design